SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001267 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001267
Domain Number 1 Region: 5-150
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.27e-44
Family Calponin-homology domain, CH-domain 0.00075
Further Details:      
 
Domain Number 2 Region: 1216-1328
Classification Level Classification E-value
Superfamily E set domains 5.54e-36
Family Filamin repeat (rod domain) 0.0000196
Further Details:      
 
Domain Number 3 Region: 1419-1527
Classification Level Classification E-value
Superfamily E set domains 1.4e-33
Family Filamin repeat (rod domain) 0.00000214
Further Details:      
 
Domain Number 4 Region: 1026-1135
Classification Level Classification E-value
Superfamily E set domains 7.34e-32
Family Filamin repeat (rod domain) 0.0000506
Further Details:      
 
Domain Number 5 Region: 338-456
Classification Level Classification E-value
Superfamily E set domains 1.53e-31
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 6 Region: 1740-1835
Classification Level Classification E-value
Superfamily E set domains 5.87e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 7 Region: 1330-1442
Classification Level Classification E-value
Superfamily E set domains 2.27e-30
Family Filamin repeat (rod domain) 0.0000219
Further Details:      
 
Domain Number 8 Region: 1925-2018
Classification Level Classification E-value
Superfamily E set domains 2.44e-30
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 9 Region: 947-1038
Classification Level Classification E-value
Superfamily E set domains 1.13e-29
Family Filamin repeat (rod domain) 0.00000941
Further Details:      
 
Domain Number 10 Region: 554-650
Classification Level Classification E-value
Superfamily E set domains 3.54e-29
Family Filamin repeat (rod domain) 0.00047
Further Details:      
 
Domain Number 11 Region: 639-752
Classification Level Classification E-value
Superfamily E set domains 1.4e-27
Family Filamin repeat (rod domain) 0.00081
Further Details:      
 
Domain Number 12 Region: 1125-1238
Classification Level Classification E-value
Superfamily E set domains 2.87e-27
Family Filamin repeat (rod domain) 0.0000163
Further Details:      
 
Domain Number 13 Region: 742-852
Classification Level Classification E-value
Superfamily E set domains 3e-27
Family Filamin repeat (rod domain) 0.00058
Further Details:      
 
Domain Number 14 Region: 446-548
Classification Level Classification E-value
Superfamily E set domains 3.14e-27
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 15 Region: 2520-2610
Classification Level Classification E-value
Superfamily E set domains 1.6e-26
Family Filamin repeat (rod domain) 0.00000328
Further Details:      
 
Domain Number 16 Region: 2198-2289
Classification Level Classification E-value
Superfamily E set domains 2.07e-26
Family Filamin repeat (rod domain) 0.00000717
Further Details:      
 
Domain Number 17 Region: 1516-1629
Classification Level Classification E-value
Superfamily E set domains 1.47e-25
Family Filamin repeat (rod domain) 0.0000589
Further Details:      
 
Domain Number 18 Region: 161-256
Classification Level Classification E-value
Superfamily E set domains 4.14e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 19 Region: 2389-2481
Classification Level Classification E-value
Superfamily E set domains 6.07e-25
Family Filamin repeat (rod domain) 0.00000317
Further Details:      
 
Domain Number 20 Region: 260-360
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.00099
Further Details:      
 
Domain Number 21 Region: 2296-2386
Classification Level Classification E-value
Superfamily E set domains 2.2e-23
Family Filamin repeat (rod domain) 0.00000461
Further Details:      
 
Domain Number 22 Region: 841-941
Classification Level Classification E-value
Superfamily E set domains 1.04e-21
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 23 Region: 2131-2212
Classification Level Classification E-value
Superfamily E set domains 1.13e-19
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 24 Region: 1843-1939
Classification Level Classification E-value
Superfamily E set domains 5.2e-18
Family Filamin repeat (rod domain) 0.0000946
Further Details:      
 
Domain Number 25 Region: 1677-1756
Classification Level Classification E-value
Superfamily E set domains 9.34e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001267   Gene: ENSMLUG00000001339   Transcript: ENSMLUT00000001378
Sequence length 2611
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429813:7584257:7606994:-1 gene:ENSMLUG00000001339 transcript:ENSMLUT00000001378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSADSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKV
PQLPITNFNRDWQDGKALGALVDNCAPGLCPDWAAWDPNQPVENAREAMQQADDWLGVPQ
VIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLYPKKAIAYGPGIEPQGNTVL
QPAHFTVQTVDAGLGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVL
FAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVV
IVDPQGRRDTVEVALEDKGDSTFRCTYRPVMEGPHMVHVAFAGAPITRSPFPVHVAKACN
PNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVF
ECEYYPVVPGKYVVTITWGGYAIPRSPFEVQVSPEAGTQKVRAWGPGLETGQVGKSADFV
VEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSP
FIAHIQPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCP
IDIKVIPNGDGTFRCSYVPTKPIKHTIIVSWGGVNVPKSPFRVNVGEGSHPERVKVYGPG
VEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKY
TPPGAGQYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVL
TKGAGKAKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAIQQGNMAVTVTYGGDPVPK
SPFVVNVAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVKMTSPSRRPIPC
KLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLK
GGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINI
LFAEAHIPGSPFKATIQPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEIL
SDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGI
KVSGPGVEPHGPGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGT
YRVQYTAYEEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANHF
TVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGS
PFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPV
EVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPSSPFKIKVLPAHDASKVRASGPG
LNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSG
RYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITV
DAKAAGKGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNS
PFHVLACDPMPHVEEPPDVLQLHQPSAYPTRWATEEPVVPVEPMESMLRPFNLVIPFTVQ
KGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYV
DAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTC
TVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDL
SQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVG
PSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDG
TCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIASIGSTC
DLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVG
GDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKIEAAEIVEGENSAY
SVRFVPQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVASVPAE
FSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPD
SPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDAKVHTPSGAVEEC
YVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPG
LEGGTTGVSSEFIVNTMNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIA
IKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSD
ASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNV
TYTVKEKGDYILIVKWGDESVPGSPFKVNVP
Download sequence
Identical sequences G1NVG9
ENSMLUP00000001267 ENSMLUP00000001267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]