SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001701 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001701
Domain Number 1 Region: 89-319
Classification Level Classification E-value
Superfamily L domain-like 6.8e-40
Family Leucine rich effector protein YopM 0.068
Further Details:      
 
Domain Number 2 Region: 641-751
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-25
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001701   Gene: ENSMLUG00000001866   Transcript: ENSMLUT00000001870
Sequence length 761
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:21003410:21107890:1 gene:ENSMLUG00000001866 transcript:ENSMLUT00000001870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASQGGGGNSGGGGGGGGGSSGGCGAAGGGGGAGGGGGGGGTAVLPIPVPTLFGQPFPN
GPQWNPGSLQPQHTARSLDRALEEAGNSGILSLSGRKLRDFPGSGYDLTDTTQADLSRNR
FAEIPSDIWLFAPLETLNLYHNCIKTIPEAIKNLQMLTYLNISRNLLSTLPKYLFDLPLK
VLVISNNKLVSIPEEIGKLKDLMELDISCNEIQVLPQQMGKLHSLRELNIRRNNLHALPD
ELGDLPLVKLDFSCNKVTEIPVCYRKLHNLQVIILDNNPLQVPPAQICLKGKVHIFKYLS
IQACCRMDKKPDSLDLPSLSKRMPSQPLTDSMEDFYPNKNPGPDSGIGSDNGEKRLSATE
PSDDDTISLHSQVSESNREQTSRNDSHSVGSKPDSQKDQEVYDFIDHNTEDVAVPEQGDA
HIGSFVSFLKGKEKGPEKSQKNEELGDEKRLGKELAEEEDDDLKEVTDLKKVAAQLLHQE
QKNRILNHSTSVTRNKPKENVECEKSVSADEVNSPLSPLTWQPLENQKDQTDEQPWPESQ
PIIWQSEERRRSKQIRKEYFKYKSSRKSSSGNENDEQDSDNANMSPQSPVSSEEYDRTDG
FSHGPFGLKPRSAFSRSSRQEYGAADPGFTMRRKMEHLREEREQIRQLRNNLESKLKVIL
PDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLDACKKLGV
SQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSMA
Download sequence
Identical sequences G1NWJ0
XP_006082266.1.53796 ENSMLUP00000001701 ENSMLUP00000001701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]