SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002090 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002090
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.06e-80
Family Calponin-homology domain, CH-domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 232-354
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-35
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 468-586
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-30
Family Spectrin repeat 0.0000053
Further Details:      
 
Domain Number 4 Region: 355-463
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-25
Family Spectrin repeat 0.0000036
Further Details:      
 
Domain Number 5 Region: 595-702
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-20
Family Spectrin repeat 0.00000494
Further Details:      
 
Domain Number 6 Region: 695-826
Classification Level Classification E-value
Superfamily EF-hand 4.34e-20
Family EF-hand modules in multidomain proteins 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002090   Gene: ENSMLUG00000002293   Transcript: ENSMLUT00000002299
Sequence length 854
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429952:1370364:1398223:1 gene:ENSMLUG00000002293 transcript:ENSMLUT00000002299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNK
ALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQ
RKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKY
LDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHL
MEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLE
INFNTLQTKLRLSNRPAFMPSEGRMVSDINNCWQHLEQAEKGYEEWLLNEIRRLERLDHL
AEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIA
AIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLETIDQLHLEYA
KRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEA
QRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALEEQSKQQSNEHLRRFAS
QANIVGSWIQTKMEEIGRISIEMNGTLEDQLSHLKQYELSIVDYKPNLDLLEQQHQLIQE
ALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNH
FDKNHGGRWGPEEFKACLISGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSR
ETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALD
YKSFSTALYGESDL
Download sequence
Identical sequences G1NXI9
ENSMLUP00000002090 ENSMLUP00000002090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]