SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002109 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002109
Domain Number 1 Region: 344-449
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-29
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002109   Gene: ENSMLUG00000002314   Transcript: ENSMLUT00000002320
Sequence length 1133
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:1726049:1923482:-1 gene:ENSMLUG00000002314 transcript:ENSMLUT00000002320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFIFQESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFL
REGKATDEDMQSLASLMSMKQADIGNLDDFEEDNEEDDENRVDQEEKAAKITEIVNQLNA
LSSLDEDQDDCIKQANMPSAKSASSSEELINKLNFLDEAEKDLATVNLNPFGDPDVTGLN
PFEDPDSEEPTTETVSPKKPEESFYNNSYNLFKEIQTPQYLNPFGEPETFETIKDSPPQS
TKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKPTPPPNNLINPIQELESEKRVKR
KAPAPPVISPKMGGVNENTVVSAGKDLSTSPKPSPIPSPILGRKPNASQSLLVWCKEVTK
NYRGVKITNFTTSWRNGLSFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISR
LLEPSDMVLLAIPDKLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDTNSS
VDQEKFYAELSDLKQEPELQQPTSTAVDFLSQDDSVFVNDSGVGESESEHQTPDDHLSPS
TASPYCRRTKSDTEPQKSQQSSGRTSGSDDPGICYSTDSTHAQVLLGKKRLLKAETLELS
DLYVCDKKKDVSPPFICEVTGEPKLQTLDISSNLEQEKLENSRPLECRSDPESPIKKTSL
SPTSKLGSSYNRDADLAKKKHTSLRQTESDPDADRTTLNHSDHSAKTVQQRMLSRQEELK
ERARVLLEQARRDAALKAGNKQNTNSATALCNRQLSDQQDEERRRQLRERARQLIAEARS
GVKMSELPSYGEMATEKLKERSKASGDENDNIEIDTNEEIPEGFVVGDGDELTNLENDLD
IPEQKTKLVDLKLKKLLEVQPQVANSLSSASQKVITESSEQDIKNGTEDLQAERLQKATE
RFRNPVVFSKDSTVRKTQLQSFSQYVENRPDIKRQRSIQEDTKKGNEEKAAITETQRKPS
EDEVLNKGFKDTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQE
WFMLVNKKNALIRRMNQLSLLEKEHDLERRYELLNRELRAMLAIEDWQKTEAQKRREQLL
LDELVALVNKRDALVRDLDAQEKQAEEEDEHLERTLEQNKGKMAKKEEKCVLQ
Download sequence
Identical sequences G1NXK5
ENSMLUP00000002109 ENSMLUP00000002109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]