SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002497 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002497
Domain Number 1 Region: 188-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-51
Family DBL homology domain (DH-domain) 0.000000286
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-39
Family Calponin-homology domain, CH-domain 0.0057
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-29
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 
Domain Number 4 Region: 637-766
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-27
Family SH2 domain 0.00064
Further Details:      
 
Domain Number 5 Region: 803-873
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-22
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 6 Region: 586-665
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000002
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002497   Gene: ENSMLUG00000002741   Transcript: ENSMLUT00000002746
Sequence length 875
Comment pep:novel scaffold:Myoluc2.0:GL429868:4125019:4282153:1 gene:ENSMLUG00000002741 transcript:ENSMLUT00000002746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWRQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRARSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESVSDEDIYKALPDLIDETHVEDEEGLYDCVYGEDEGGEVYEDLMKAE
EAQQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQIFINYKERLVIYGQYCSAVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIRQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQES
KIFLFFLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGHNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDHADSNFHEFKMHTFSRVTSCKACQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSAESGTLKAPEKRTNGLRRTSRQVDAGLPKMQVI
KNYAGTPPPAPHAGPPLHIQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRPNSTYLVRLRTKESGEYAISIKYNNEAKHIK
IVTRDGLFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEPAAGQRGSRV
GSSSPSLFCGFSLVPPPDFSFVPPSSTPFWSVLSPKVLGIAVARYDFCARDMRELSLLKG
DVVKIYTKMSGNGWWRGEANGKVGWFPSTYVEVDE
Download sequence
Identical sequences G1NYK2
ENSMLUP00000002497 ENSMLUP00000002497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]