SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002973 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002973
Domain Number 1 Region: 101-202
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000153
Family Calponin-homology domain, CH-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002973   Gene: ENSMLUG00000003261   Transcript: ENSMLUT00000003270
Sequence length 1290
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431050:732:19037:-1 gene:ENSMLUG00000003261 transcript:ENSMLUT00000003270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDALMMAYTVEMISIEKVVASVKRFSTFSASKELPYDLEDAMVFWVNKVNLKMREITEK
EGKLRQQFLESPAHQKSPSKWYWKLVPVRYRREHLSARQPPYFPLLEDLMRDGSDGAALL
AVVHYYCPKHMKLDDVCLKEVMSMADSLYNIRLLREFSNEYLNRCFYLTLEDMLYAPLVL
KPNVMVFIAELFWWFENVRPDFVQPRDVQELKDAKTVSHQKSSRPPVPISNATKRSFLGG
PAAASPAEPPAPAQPPAEGCPRQHLHPEEPDPLGRGASAFSPSHPLLPLRQRQQRAAPGE
DPPDERHRSSSLTRVDGQPRGAAVAWPEKKHRPASQPAPFALHHTASCDADPGSGDSVSL
ARSISKDSLASNILPLTPQNQPQTPALRASGKSLLNNVDIEDEDEELMAIVRTNGAPHGS
DRGPTTSARSPQRPAGPSESKLDSFFLEPLMPAVLRPAKEKQAVSKEDECGEGRLRGCAA
RRPSEGPPLGRRKAPGSSGTRDLNRTFTPISSVELCAEVGLPAGEARGEPLASGSFNPSS
QGQSPDGFFLHVARADEAPEGGLHGTRARSPLARDPEPWTVLRQDSDSDVADLEEAEHDF
LGEDLPVLMGRYAGEEESAKLQEDMQVKEHEDKDGASGRSSPCLSTFSQFSGGFVAAGRA
RMPTLQRGKLQRTAMSQSPVRAASQKTTPDGLGELPRAPPDPRGSKKRGAEPRAGQGWDH
ASLLASWVQLHMQLEEKRRAIEAQKKKMELSARQRLKLGKAAFLHVVKKGKAEAGPQPLK
PEPNEEDFSGAVSKTEEFLAREQGRGDAGECQDTDREGLALLQQHRQDPAALPELEKSKA
LSAALLEVAGDGLDTGEGDLSIEKLNETISTLQQAILRISQQQEQLLLKSPVPPAPGARN
NAADPKVRASIHFVEPLSPTGVTGHRRPPRLGQGRNSRSGRPAELKVARDRQQGSRSKTP
TPSVEALPHLRPFPPRTPPDPGDPGSDPPEKGFFDSYRLHDASNQRALTLPSPRDANILS
EQMSLKEALGLGLREAGLGAPAVSGKEGVPVDGPPRSKASLIEVDLSDLKAPDEDGPTGP
ESSVDLSTDGDQKSGVGFFFKKEEAQEDELAKKRAAFLLKQQRKAEEARMRKQQLEAEVE
LKRDEARRKAEEDRIRKEEEKARRELIKQEYLRRKQQQILEEQGLGNQKAKPRKPRPKSV
HREEPRGDSGTKCSSTPENLSRAQSGSSLSLASAATTEPESVHSGGTPAPRVESLEALPI
LSRNPSRSTDRDWETASAASSLASVAEYTG
Download sequence
Identical sequences G1NZR9
ENSMLUP00000002973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]