SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003118 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003118
Domain Number 1 Region: 389-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.56e-37
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 87-236,377-447
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.054
Further Details:      
 
Domain Number 3 Region: 991-1024
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000371
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 1025-1054
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000784
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003118   Gene: ENSMLUG00000003421   Transcript: ENSMLUT00000003428
Sequence length 1121
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429828:2377311:2466882:-1 gene:ENSMLUG00000003421 transcript:ENSMLUT00000003428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQSQAGQIFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTSW
KAKALWHKLDKRGSHKEYKRGKSCVNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALILGVEIHVN
VEFVNVREPPQKSXXVEIGWRAEFLPADHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDHLLSYAREAADFATNYQLPSLDFAMNH
YEQPDVAMFDFTCMYASENAALVRERQNHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGAPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVR
PHQVKHLYITKELHHSPLKRLGSMRRSVGLSRRESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWGKNYGENDDLGVAKSSLPHNYLNLTFPR
KRTPRVDNQTEENNDMNKRRRRGFNSLHEVCVHSVGSLGSSQEGSVSKEGGNQNKVKSMA
SQLLAKFEESSRNPSLLKQECHVSGIGKPVLRSSSDPPAHSRCLQPEEPTASPPPPLKRQ
LPSVVVTGHVLREINQVSAGGECPSRPRRARAQSDLQLGGREENPACQGALALSGVLRRL
QLVEEKILQKRAQNLANREFHQKNIKEKAAHLASMFGHGDFPQNKLLSKGLSPTQPPSSP
SCLPSPDPAAASSPSAVDSVSPARKAKKSPSGFHFHPSHLGAVWPHLTVGKVSSGIGAAA
EVLVNLYMNDHRPKAQATSPDLETTRKAFPLNLGGSDTCYFCKKRVYVMERLSAEGHFFH
RECFRCSVCATTLRLAAYAFDGDEGKFFCKPHFIHCKANSQQRKRRADLKQQREEEGMWP
EHEAPRQEPPTESSCAAAALGPPTGSPPVPFSLPVLHPLLG
Download sequence
Identical sequences G1P050
ENSMLUP00000003118 ENSMLUP00000003118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]