SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003127 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003127
Domain Number 1 Region: 11-178,224-334
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.6e-51
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003127   Gene: ENSMLUG00000003439   Transcript: ENSMLUT00000003437
Sequence length 336
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429828:2163938:2210193:-1 gene:ENSMLUG00000003439 transcript:ENSMLUT00000003437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGKGVTAGRVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQE
LMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQK
LQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVV
VVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHL
NKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQD
GGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVD
Download sequence
Identical sequences G1P057
ENSMLUP00000003127 ENSMLUP00000003127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]