SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003651 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003651
Domain Number 1 Region: 5-130,164-271
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.99e-75
Family Calponin-homology domain, CH-domain 0.0000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003651   Gene: ENSMLUG00000004004   Transcript: ENSMLUT00000004008
Sequence length 1001
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430543:102285:131939:1 gene:ENSMLUG00000004004 transcript:ENSMLUT00000004008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVSLFSEERENVQKRTFTRWINLHLEKCDPPLEVKDLFIDIQDGRILMALLEVLSGRNLL
HEYKSSSHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNPSLVLGLIWNIILFFQIK
ELTGNLSRNSPPSSLSPGSGGTDSDSSFPPTPTAERSAALSVKDQRKAIRTLLAWVQRKT
RKYGVAVQDFAGSWRSGLAFLAVIKAIDPSLVDMKAALEDSMPENLEKAFRIAHDALHIP
RLLEPADIMVDTPDEQSIVTYVAQFLEHFPELEAEDFVDPDKDAPIESTFVRIKETPSEQ
ESTVFYVTDDGERAYTVNHDTSHPPPSKVFVCDKPARGKDSRPGGAPGPTPANSPAEVTP
QGTDWDTLGASGRTCSLSEAPPESSILSRKDNQRSSSLPGKKTVHFEADVYKDASCSKDP
VHSQDCGFEGGHRGTKDLWKQDGHGPEVAEERPRHDAPEAAPDQALDDVCLADSQTGPSQ
TPQGSAPRNRASERPASPGEESCPRARLGEETVMADSSELKVKPQTAEAMDEEDDFEGIP
LKASKFNSDLVDFASTSQAFGEDPPPAEDGPAEAGAAEAQAENLGNGRSTSAPRMEGADE
PPGKPGHEDHSRVVAPEEEPGGRKPEVYEKAKRKSPRPPRGEEEAEAEDPPAFEGDLPSN
PPSSQVSLETLGSHSEEGLDFKRSPPLSKVSVIPHDLFYYPHYEVPLAAVLEAYAEGQED
FKAEDADFEDPEDYLSDLEQREDEDEPEASESSGSFRGLGEDRPQPPTQEPDRDQGAQGA
KPASGPPPTLAPEDHQQREATARAPGESQQSQESPNSENLRNPLEEKVMEESVSSKKKEK
KKHVDDVESSVLLTPGAVRSSDDLDEDPGFHRVPSRTSHSDSSIYIRRHTNRSLESVSMR
LSSSSERHWNFTVGSYNTQRLTELILQFYGIRADMKRECKHARMSMKANHSGEASLRESQ
SPRSDSLTQFVQQPDMMYFILFLWLLVYCLLLFPQLDVNRL
Download sequence
Identical sequences G1P1G2
ENSMLUP00000003651 ENSMLUP00000003651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]