SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004631 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004631
Domain Number 1 Region: 242-364
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.16e-34
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004631   Gene: ENSMLUG00000005080   Transcript: ENSMLUT00000005077
Sequence length 367
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430089:155389:174832:1 gene:ENSMLUG00000005080 transcript:ENSMLUT00000005077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCSPAPGTTGTPSPSAGAWAFPEHAPRLGSARFASRTFSISGRGQSVDHHDEASESEMRR
SSNLCVIENGHQPGAGPGDGPPEATQTFRAPEPPKPRPMSLSLGLPHQPVTAVMRVSERF
SGETSATALSPTSAAVLGGLSSSPSEATTPWTLSPNEKNSSLPRSLGSGYGAVTAGRSND
SPPLVTPPQSPPSPQPPATTQAHRRELVRSQTLPRTSSAQARKALFEKWEQDTVGKGKGE
ARAKLKRSQSFGVASASSIKQILLEWCRNKTLGYQHVDLQNFSSSWSDGMAFCALVHSFF
PDAFDYSALSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLY
NHLRRFE
Download sequence
Identical sequences G1P3X1
ENSMLUP00000004631 ENSMLUP00000004631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]