SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004856 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004856
Domain Number 1 Region: 2-221
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.68e-59
Family Calponin-homology domain, CH-domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 240-361
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-30
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 3 Region: 370-472
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-23
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 4 Region: 786-918
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-22
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 1629-1732
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-20
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 1158-1310
Classification Level Classification E-value
Superfamily Spectrin repeat 3.98e-20
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 7 Region: 474-580
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-18
Family Spectrin repeat 0.00096
Further Details:      
 
Domain Number 8 Region: 1526-1626
Classification Level Classification E-value
Superfamily Spectrin repeat 9.48e-18
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 682-776
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-16
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 1383-1506
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000018
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 11 Region: 541-667
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 1318-1416
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000768
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 13 Region: 1727-1791
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000127
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004856
Domain Number - Region: 1123-1172
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0137
Family Spectrin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004856   Gene: ENSMLUG00000005301   Transcript: ENSMLUT00000005321
Sequence length 1792
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431165:8972:61922:1 gene:ENSMLUG00000005301 transcript:ENSMLUT00000005321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDEREAVQKKTFTKWVNSHLAQGCHIGDLYASLGLGLGSLMRPQLPRPTRGRMRIHSLEN
VDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRETRSA
KDALLLWCQMKTAGYPSIHPSNVWLSLSPSPLLTHSVPLPRPDLVDFSKLTKSNTNYNLQ
RAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLD
QVLEVEKIIERYEELATELLAWIRRTVGLISNQKFANSLSGVQQQLQAFMAYCTLEKPAK
FQEKGNLEVLLFSIQSKLRACNRRLYVPREGCGIWDIDKAWGLLEKAEHEREAALRAELT
RQEKLGLLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIAAYE
ERVQGVAELAQALATEGYYDARRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKVFQ
EMVYMVDWMEEMQAQLLSQECGQHLVEAEDLLQKHGLLEGDIAAQSERVEALNAAALRFS
QLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALFQELEEAESWARD
KERLLEATGGGGGGGGGGAGVAGGAHDLSSTARLLAQHKILQGELGGRRAMLQQALRRGE
ELAAAGGAEGSGAEAVHLVGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGADLD
GLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVTSLRRQLATLGGAS
GAGPLVVALQVRVVETEQLFAEVTEMAALRRQWLRDALAVYRMFGEVHACELWIGEKEQW
LLGMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVLSCQD
HLNSRWNRIVELVEQRKEQASAVLLVENHVLEVAEVRAQREKRRAVESTPRAGGLQWRLS
GLEAALXEWLPAFVTYLEGNGLMGFQKTLGVDNLYPNRTEGKNYGRRLADDLIGAGSLQI
LRRRLRNQVCWFSGNSDPISRSFWLGNQGWDLGKIEHQFSDCPRVGPTSGDHLRKSDHQC
WSPRESLDSWVPYVHPGWPPLPGPGMGDWGVGRVSDLCTTLQELALSGLELPGTVESVEE
ALKQHRDFLTTMELNQQKMHVAVQAAEGLLRQGNIYGEQAQEAVAQLLEKSQENQLRAHQ
WMQKLHDQLELQHFLRDCHELDGWILEKMLMARDGTREDGHKLHKRWLRHQAFMAELAQN
KEWLEKIEREGQQLMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLV
QSFAELDKKLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWYREVGELQAQTAAL
PLEPASKELVGERQNAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELAWVQERLP
LAMQMERGSGLQAVQQYIKKNQGLRREIQAHPRLEEVLERAGALAVLPAPRRRRRVRVQE
QLQSAWAGHARGDRAQQALDAAFPSQYYFDLAELEAWVSSKNWFLMRENKDKDEQSTLQL
LKKHLQLEQGVENYEDSIAQLSRQCRALLELGHPDSEQISRRQSQVDRLYVALKELGEER
RVGLEQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFEHVTVLQEKFSEFASETGTA
GRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKF
FSDARELQGQIEEKRRRLPHLTTPPEPRPSASAMQRTLRAFEHDLQLLVSQV
Download sequence
Identical sequences G1P4H0
ENSMLUP00000004856 ENSMLUP00000004856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]