SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004932 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004932
Domain Number 1 Region: 121-632
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.36e-159
Family Calponin-homology domain, CH-domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily EF-hand 4.89e-17
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004932   Gene: ENSMLUG00000005398   Transcript: ENSMLUT00000005404
Sequence length 639
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:20583862:20619164:-1 gene:ENSMLUG00000005398 transcript:ENSMLUT00000005404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKLID
FSNSVKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQ
FVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLG
VNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGK
HPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVSWVNKT
LREAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVS
MARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences G1P4P1
ENSMLUP00000004932 ENSMLUP00000004932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]