SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005071 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005071
Domain Number 1 Region: 1012-1116
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-31
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005071
Domain Number - Region: 684-747
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0916
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005071   Gene: ENSMLUG00000005549   Transcript: ENSMLUT00000005555
Sequence length 1118
Comment pep:known_by_projection scaffold:Myoluc2.0:AAPE02059505:5013:42929:-1 gene:ENSMLUG00000005549 transcript:ENSMLUT00000005555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKASRSVGSVPKVSGISKTQTVEKTKPENSSSASAGGKLVKPGPAAALSKTKSSDDLLA
GMAGGVTVTNGVKGKKSTCPSTASSASAPAMTTVENKSKMSTGTTSSTKRSTSTGSKESG
STRERLRERPRLNPSKKLPSAGQGAGDAALPKRSRSRTAAECDVRMSKSKSDNQISDKAA
LEAKVKDLLSLATTKDAEIFHLRSELRDMRAQLGMNEDPAEGEEKCEEKEAMMAHQPTDV
ESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEIT
PGNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSESSEVYQPLTSS
DDALDAPSSSESEGVPSTERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQ
ELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISYVI
DEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKE
RNHHMERIVESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNS
GDKSDIQDLLESVRLDKEKAEALASSLQEDLAHTRNDANRLQDAIAKVEDEYRAFQEEAK
KQIEDLNMTLEKLRSELEEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVK
KLQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLH
EAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTP
TVKTLIKSFDSASQVPNPNAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLT
ALSDKRPNYGEIPVQEHLLRTSSTSRPASLPRVPAMDSAKTISVSRRSSEEMKRDISAPE
GASPASLMAMGTTSPQLSLSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNALLK
WCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKRRNFTLAFQAA
ESVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences G1P512
ENSMLUP00000005071 ENSMLUP00000005071 XP_006108082.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]