SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005136 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005136
Domain Number 1 Region: 3-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-73
Family Calponin-homology domain, CH-domain 0.00000445
Further Details:      
 
Domain Number 2 Region: 1483-1689
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-44
Family Plakin repeat 0.00022
Further Details:      
 
Domain Number 3 Region: 1694-1877
Classification Level Classification E-value
Superfamily Plakin repeat 2.75e-40
Family Plakin repeat 0.00084
Further Details:      
 
Domain Number 4 Region: 6415-6574
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-29
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 6245-6358
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 216-332
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-27
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 6656-6791
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-26
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 5756-5913
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-24
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 5214-5370
Classification Level Classification E-value
Superfamily Spectrin repeat 3.73e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 10 Region: 5998-6137
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 11 Region: 6087-6237
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-22
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 12 Region: 6786-6902
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-21
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 13 Region: 4777-4931
Classification Level Classification E-value
Superfamily Spectrin repeat 3.09e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 14 Region: 3995-4133
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-20
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 15 Region: 7149-7228
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.93e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 16 Region: 4444-4573
Classification Level Classification E-value
Superfamily Spectrin repeat 1.74e-19
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 17 Region: 6573-6686
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-19
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 18 Region: 6852-6979,7009-7040
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 19 Region: 5649-5796
Classification Level Classification E-value
Superfamily Spectrin repeat 1.74e-18
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 20 Region: 5366-5482
Classification Level Classification E-value
Superfamily Spectrin repeat 6.33e-17
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 21 Region: 4990-5149
Classification Level Classification E-value
Superfamily Spectrin repeat 3.57e-16
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 22 Region: 650-752
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000107
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 23 Region: 7060-7140
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000143
Family Polcalcin 0.044
Further Details:      
 
Domain Number 24 Region: 1185-1313,1340-1368
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000088
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 25 Region: 5913-6026
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000222
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 26 Region: 4665-4787
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 27 Region: 3753-3862
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000266
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 28 Region: 5485-5591
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000903
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 29 Region: 3913-4026
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000017
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 30 Region: 4193-4313
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000036
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 31 Region: 4574-4678
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000496
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 32 Region: 719-832,953-972
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000023
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 33 Region: 4352-4461
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000259
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 34 Region: 557-649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000144
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 35 Region: 3253-3367
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000619
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 36 Region: 3324-3490
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00004
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005136
Domain Number - Region: 978-1120
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000648
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 3507-3621
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00144
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005136   Gene: ENSMLUG00000005610   Transcript: ENSMLUT00000005622
Sequence length 7443
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429847:2350652:2574272:-1 gene:ENSMLUG00000005610 transcript:ENSMLUT00000005622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLV
NIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGI
RCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVNRLLDPE
DVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHV
TTMSERAFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQ
GYHPNDIEKEWGKLIIAMLEREKALRPEVERLEMLQQIAHRVQRDSVICGDKLILARNAL
QADSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYHADQLVQRVAKLRD
EIMALRNECSSVYSKGRMLTTEQTKLMISGITQSLNSGFAQTLNPSLNSGLTQSLTPSLT
PSSVKSGLSSGLTSRLTPSLTPVYTPGFPTGLVPNFNSGVETNALQTLKLMQIRKPLLKS
SLLDQNLTEEEINMKFVQDLLNWVDEMQGQLDRTEWGSDLPSVESHLENHKNVHRAIEEF
ECSLKEAKISEIQMTAPLKLTYAEKLHRLESLYAKLLNTSRNQERHLDTLHNFITRATNE
LIWLNEKEEEEVAYDWSERNTHISRKKDYHAELMRELEQKEENIKSVQEIAEQLLLENHP
ARLTIEAYRAAMQTQWSWVLQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRK
YSCDRSSSIHKLEDLVQESMEEKEELLQYKSTVASLVGRAKTIIQLKPRNPDCPLKTSIP
IKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFSVPPPNKEAVDF
ANRIEQQYQNVLTLWHETHINMKSVVSWHYLINEIDKIRASNVASVKTMLPGEHQQVLSN
LQSRFEDFLEDSQESQIFSGPDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISE
VRNIRLRLENCEDRLIRQIRTPLERDDLHESVFKITEQEKLKKELERLKDDLGTITNKCE
DFFSQAAASPSVPTLRSELSVVLQNMNQVYSMSSIYIEKLKTVNLVLKYTQAAEALVKLY
EMKLCEEEAVTADKNNIENLISTLKQWRAEVDEKREVFHSLEDELQKAKAISDEMFKTYK
ERDLDFDWHKEKADQLAERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVEI
TQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSIAVKDYELQTMT
YRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALLTLMTQYIKFAGDSLKRLEEE
EKSLEEEKKEHVEKAKELQKWVSNISKMLRDGEKAGKSPFSKQKISSEEILTKKEQLSEA
LQTMQIFLAKHGDKLTDEERNELEKQMKTLQESYNLFFSDSLKQLQESQTTGDVKVEEKL
DKVIAGTIDQTTGEVLSIFQAVLKGLIDYDTGIRLLETQLMISGLISPELRQCFDLRGAK
SQGLIDEQVLCQLKELNQAKEIISAVPSTTIPVLDALAQGVISESIAIRVLEILLSTGSL
VIPVTGEQLTLQKAFQQNMVSSALFSKVLERQKMCKDLIDPCTSEKVSLVDIMERSILQE
NTGLRLLPVRPQEGGRITLKCGRSISILRAAHEGLIDRETMFRLLGAQLFSGGLINCNSG
ERMTVEEAVADGVIDRDTANSILTYQVQTGGIIHSNPAKRLTVDEAVQCDLITSSSALLV
LEAQRGYVGLIWPHSGEIFPASSSLQQKLITNELAYKILNGRQKIAALYIPETSQVIGLD
VAQQLGIIDNNTTLILKSIILPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDS
FDGEEPVATQSSEQTKKMFLSYLMINSYMDANTGQRLLLYDGDLNEAVGMLLEGCSTEFD
EDTPIKECIDALRLPGVFLNNAPSKEMDESITSRSSFDKCHCGEPKPKEIPENRKHAIEE
EFNEMGTNVLSEFCQSENLIHIMVADHKVKNSSSVNVVNSASYFTQSGLADSENIPKNCE
SQSQVEKNEHATECSHSKNMQNLESDLTTNSIVKSKTSSICNLKETETEDNIDKESPVFD
YSPRLSALLSHDKLRNDWGSFNDLHTAENNGNKWEASTVPSNDKSTLLGPRMGEQPQDQF
LGIAAINISVKGEHCGQKPLNTAHSDPQVQYHNDKAISDTSGEDEKMHAASQQKPEDMQN
ESTVEEYSCAVTPTGDPDHASASHVYGTSSLEETAGAGDYEMSLLDDQQRDTETDTDSDD
DFYDTPLFEDDDHDSLLLESDDCDCLQPEDYDTLQEENDGAACPGNVFYDVPREDEKPMV
IQGGLVDSLRVRGKAQSFQDCLIGMEEAELDSDERIPLNSVGSSKINEQLLETESEREST
DNLEGDESDLLTDSEIVGRKDSFSASLTFDDTGCWGGRKEEGYVTGQELKSDTDHFDSMQ
YEESYGDYLCDSNGQDDDDDDDDEEEEEEEEEEEEEEEKEKTMYQDEADGMDIQLCAATM
KERENSHENQSINEMILLSKKQNYTSLEKQQSVNVLQREPSSKSSLVTERGSLPEYTTEV
TVKDTESEPTFGPEGILHNTDIHSPSDQIIGSETVLIGKPAEESPLSSVDSVTDKDHQGN
GRDVMKKRDDKSNILTEDETSIHKMFPGKGEGLMEGQVEDDKHLKLLSSKSTRESLDLVT
QFPFPQITTNEGHNHKGSLKKTTVALKDEPKNLQTIVSQSPGSFGNLEEIFDSSASKVIS
DITSDVLSEGNTATENESLTDGPEKELDLFTYLKHCAKDVKAKDVLKPHEDIPSGTLIAS
PPMKEHLELGVDNANEKATLTQEDSPLDEMAQQNDLCTKECTSEGGAEMPQFTPERKESA
LSILPLRNVEGLGIRSGNSSNTLSTDCTFSEMTHEKEIIKQQPREEQALSPGFQEKEVQT
PELCQAFVEDVKDILKSRLKGHMNSQEVEEPSACEDTEMLIQSLIKRVSTSQLVKDAASL
PSDDSKISDCTGISLMNNSPELRAESRDDPFCIANLQSELLLDILKQNQYSQKITGAFEL
IKELTQMEYDLEKRGMTSKVVPLQLENIFYKLLADGYSDKAEQVGNLNQKSPTTFEMVHE
KPHIVDDHKSKEGNHSSLNLQNIKEIGPENSTVCASALSRDEKLEEQCNDFPDHLECISG
SKDMTSGDSSMEQLSNELQQCLQHTSKMHEYLALLQDMKPPLDNQESLDNSLEALKNQLK
QLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRNHREELSVSLQSLQNAFSSLSDVS
SERMKHLVLAIDSEMSKLAISHGEFLHKLKSFSHWISEKSKLVKDMEPVNVQDTEHVKKS
LEFLKNVLKELGHTRMKLDTTAFDVQFFISEYAQDLSPSQSKQLLRLLNTTQRCFLDVQE
SVTTQVEHLEAQLQLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFVIG
DGTVELKKYQSKQEELQKDMQGSAQALAEIVKNTENFLKENGEKLSREDQALIEEKLKEA
KLKCEQLNLKAEQSKKELEKAVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSHVDKDS
ERAGIKQKQVIEQNGTHFQEGDSKSEMGEEDEVNGNLLETDVDGPVATTEENLNQQYQKV
KAQHEKIISQQQAVLLATQSAQALLEKQGHYLSPEDKEKLQKNMKELKAHYETALAESEK
KMKLTHSLQEELEKFDTDYGEFEHWLQQSEQELENLQAGADDFSGLMTKLKRQKSFSEDV
ISHKGDLRYITISGNRVLEAAKSCSKRDGSGQADQHNTDTSAAHREVQSKLDRATDRFRS
LYSKCSVLGNNLKDLVDKYQHYEDASCGLLSELQAFEVTASKHLSEPIAVDPKNLQRQLE
ETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYDDLSKCVNE
RNEKLQITLTRSLSVQDGLDEMLGWMAGVESSLQEPGHVPLNSAALQDVISKHIMLEQDI
ASRQSSVNAMNEKVKKFMETTDPSTASSLQAKMKDLSVRFSEASHKHKEKLASMEELKTK
VERFESLSEKLQTFLEAKTQALTEADVPGKDVTELSQYMQESTSEFLEHKKDLEVLQSLL
KEISNHGLPGDKALVFEKTNNLSKKFKEMEDTIKEKKEAVSSCQEQMDAFQVLVKSLKSW
IKETTERVPIVQPSFGAEDLEKSLEETKKLQEKWSLKTPEIQKVNDSGISLCNLISAVTT
PAKAIAAVKSGGVILNGEGTATDTQEILANKGLTSIKKDMTDISHSYEDLGLLLKDKIAE
LSTKLTKLQKAQEESSAMMQWLQKMNKTAAKWHQAPTPTDTEAVKTQVEQNKSFEAELKQ
NVNKVQELKDKLTELLEENPDTPEAPKWKQMLTEIDSKWQELNQLTVDRQQKLEESSNNL
TQFQTGEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFDTRKPQYEQLTA
AGQGILSRPGEHPAFHGIVREQLAAVTQKWDSLTGQLSDRCDRIDQAIVKSTQYQSLLRS
LSDKLGDLDNELSSSVAVSTHPDAMSQQLETAQKMKQEIEQEAKQIQVAQALCEELSALV
KEEYLKAELSRQLEGILKSFKDIEQRAEHHVQHLQLACASSHQFQQMSRDFQAWLDTKKA
ELHKSHPVSAKLDVLESLMKDQKDFNKTLTTQSSIYEKTIAEGENLLLETQGSEKAALQL
QLNTIKTNWDGFNKQVKEREDKVKDCLGKALKYKEHMETLRPWIDKCQNNLEEIKFYLDP
AETENSIAKLKSLQKDMDQHFGMVELLNNAANSLLSVCETDKEVVTEENKSLKQKVDMVT
EQLHTKKFSLENMAQKFKEFQEVSKEAKRQLQCAKEQLEAHDSLGPQAYSSKYLTMLQTQ
QKSLQTLKQQVDLAKGLAQDLVAEASDSKGASDVLLQAETLAQEHNVLSQQVDEKCSFLE
TKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDVETLQKQKEAITAFRKKLEALIAS
NDNANKTCKLMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVDGTIERLGDFY
SKLKEFSTLLQKAEELEDSQGPVAMETETINQQLNVFKVFQKEEIEPLQVKQQDVNWLGQ
GLIQSAANSTSTQGLEQDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSW
MVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIAATAEPAD
KVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLANC
EPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAISIGQSLKVLSSREDKDMVQNKLDSS
QVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLW
EQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLS
TDVAKTLEQALQLASRLHCAHEELCTWLDRVEVELLSYETQALKGEAASRAQARQKELKK
EAKSCKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTLTQKVEEIDAAI
LRSQQFDQAADAEISWITETEKKLMSLGDIRLEQDQTAAQLQVQKAFTMEILRHKDIIDE
LVKSGHKIMTTCSEEEKQSMKKKLDKILKNYDSICQINSERYLQLERAQSLVNQFWETYE
ELWPWLTETQRIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLEL
SPEEGFSIQEKYVAADSLYSQIKEDVKKRAVALDDAISQSTQFHDKIDQILESLDRIVER
LRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISARA
VQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLVVTTKDTQDFIRDLEDP
GIDPSIVKQQQEAAEAIREEIDGLQEELDIVINLGSELITACGEPDKPIVKKSIDELNSA
WDSLNKAWKDRVDRLEEAMQAAVQYQDGLQAIFDWVDIAGGKLAAMSPIGTDLETVKQQI
EELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLDERIIN
RQHKLEGALLALGQFQHALDELLAWLTHTEGLLNEQKPVGGDPKAIEIELAKHHVLQNDV
LAHQSTVEAVNKAGNDLIESSAGEEASSLQNKLEVLNQRWQNVLEKTGQRKQQLDGALRQ
AKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAREQLNAHMEICAAFDVKEETYKSLM
QKGQQLLARCPESAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQDF
INWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQ
KQDVVLIKNLLISVQGRWEKVVQRLVERGRSLDEARKRAKQFHEAWTKLMEWLEESEKSL
DSELEIANDPDKLKTQLSQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDDM
LSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDI
DLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVC
ALSVSKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPEDEDALRTLIDQHKE
FMKKLEEKRAALNKATSMGDAVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLA
SALAGLIAKQELLEALLTWLQWAETTLSDKDKEAIPQEIEEVKALIAEHQTFMEEMTRKQ
PDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVNL
LVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFR
RIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKD
AYKPVTDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRS
TVMVRVGGGWMALDEFLVKNDPCRVHHHGTKMLRSESNSSITTTQPTIAKGRTNMELREK
FILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSPAVQAASPQVHATSTPKGTPIQ
GSKLRLPGYLSGKGFHSGDDSGLITTAAARVRTQFADPKKTPSRPGSRAGSKAGSRASSR
RGSDASDFDISEIQSVCSDVETAPQTYRPSPRASSRPSTAKPSKIPTPQRKSPASKLDKS
SKR
Download sequence
Identical sequences G1P566
ENSMLUP00000005136 ENSMLUP00000005136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]