SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005221 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005221
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.45e-27
Family Calponin-homology domain, CH-domain 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005221   Gene: ENSMLUG00000005712   Transcript: ENSMLUT00000005713
Sequence length 237
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430350:260735:262226:-1 gene:ENSMLUG00000005712 transcript:ENSMLUT00000005713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRFINKLQPGSVKKVNESTQNWHQLENIGNFIKAITKYGVRPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPEKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDS
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTTDYPELGEPAHNHHPHNYYNSA
Download sequence
Identical sequences G1P5E0
ENSMLUP00000005221 ENSMLUP00000005221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]