SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006101 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006101
Domain Number 1 Region: 120-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.38e-160
Family Calponin-homology domain, CH-domain 0.00000000334
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily EF-hand 1.82e-19
Family Calmodulin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006101   Gene: ENSMLUG00000006680   Transcript: ENSMLUT00000006683
Sequence length 630
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429788:9627445:9717762:1 gene:ENSMLUG00000006680 transcript:ENSMLUT00000006683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKIL
AVADNNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSY
SEEEKVAFVNWINKALEDDPDCKHLLPMNPSDGSLFKSLADGILLCKMINLSEPDTIDER
AINKKKLTPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFA
DIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLTNAGWHTINNFSQDIKDSRA
YFHLLNQIAPKGDRDDGPAIAIDLSGFNEKNDLKRAGFMLQEADKLGCRQFVTPADVVSG
NPKLNLAFVANLFNTYPCLHKPDNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYS
DLADALVIFQLYEMIRVPVNWSRVNKPPYPALGGNMKKIENCNYAVDLGKNKAKFSLVGI
AGQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKNTSI
SSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREDFSDEDKLNNAKYAISVARKIGARIY
ALPDDLVEVKPKMVMTVFACLMGKGLNRIK
Download sequence
Identical sequences G1P7J8
ENSMLUP00000006101 XP_005869362.1.60319 XP_006085830.1.53796 ENSMLUP00000006101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]