SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006745 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006745
Domain Number 1 Region: 865-970
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.12e-31
Family Calponin-homology domain, CH-domain 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006745
Domain Number - Region: 585-678
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000968
Family Myosin rod fragments 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006745   Gene: ENSMLUG00000007376   Transcript: ENSMLUT00000007390
Sequence length 972
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430122:517787:608900:-1 gene:ENSMLUG00000007376 transcript:ENSMLUT00000007390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVTATKRTGIPAPRELSATISRERTVPRGPTNPKKSVSSPTSSSTPTPTKHQRTTSTRP
RPENEGGEKAVLESQVRELLAEAKAKDSEINRLRSELKKCREKRTLNTAGTDALDPKMDG
TSVSAGDSEPLIQALEEKNKNFQKELADLEEENRALKEKLSYFEHSPNSEGGSSHTAESS
CPTSLTQESSFGSPTGNQVSGEVDEYKKHTPQTVLRTSGSSSSDVTKASLSPDASDFEHI
TADTPSRPLSSTSNPFRSSKCSTTGSSPNNASELSLASLTEKIQKMEENHHSTAEELQAT
LQELSDQQQMVQELTAENEKLVDEKTILETSFHQHRERAEQLSHENEKLINLLQERVKKE
EPSTQEGKVLELEQKCTEILEQGRCEREKLLSIQQQLTCSLRKVEEENQGALEMIQHLKE
ENEKLNGFLELERQNSSVMAQTLEECTVTLEGLKIENGSLKAYLENEKQKAIETSSMGQT
AEGCEIQEMLKVARAEKDQLELSCTELKQELLKAHGEIKHVSSLLAKVEKDYSYLKEICD
HQAEQLSRTSLKLQEKASESDAEIKDMKETIFELEDQVEQHRAVKLHNNQLISELESSVM
KLEEQKADLERQLKTLTKQIKEETEEWRRFQADLQTAVVVANDIKCEAQQELRTVKRRLL
EEEEKNARLQKELGDMQGHGRLVMSGAPEPVRAESEPEADAPGRWPGVFVSRASTAPLEP
ATTVKSLIKSFDLGHPGGAGQNVSVHKPPRSPLSGIPVRTAPAAAVSPMQRHSTYSGVRT
ASKGVAQRLDLPDLPLSGLLKGRADDLKPDPYLRKSPSLESLSRPPALGFGSTRLLSTST
GGLRPHSKLSVERRDPLAALAREYGGSKRNALLKWCQKKTEGYANIDITNFSSSWSDGLA
FCALLHTYLPAHIPYQELSSQEKKRNLLLAFEAAESVGIKPSLELSEMLHTDRPDWQSVM
QYVAQIYKYFET
Download sequence
Identical sequences G1P960
ENSMLUP00000006745 ENSMLUP00000006745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]