SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007133 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007133
Domain Number 1 Region: 232-431
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-47
Family DBL homology domain (DH-domain) 0.0000000829
Further Details:      
 
Domain Number 2 Region: 424-548
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-34
Family Pleckstrin-homology domain (PH domain) 0.00000179
Further Details:      
 
Domain Number 3 Region: 1-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-26
Family Calponin-homology domain, CH-domain 0.00072
Further Details:      
 
Domain Number 4 Region: 162-232
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-24
Family SH3-domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007133   Gene: ENSMLUG00000007783   Transcript: ENSMLUT00000007810
Sequence length 777
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:3549727:3668755:1 gene:ENSMLUG00000007783 transcript:ENSMLUT00000007810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEEQIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLRPGSVEKYCLEP
QTEADCINNINDFLKGCVTLQVEVFNPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANSSQTNPQGAVSSTAPRLQRQSKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAIKGFETTPLTKN
YYSVVLQNILDTEKDYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDVLKAIIAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKTLGNVIFMSQVMVQYGTCEEKEERYLMLFSNVLIM
LSASPRMSGFIYQGKIPIAGMVVTRLDEIEGNDYTFEITGSHILERIVVHCSNNQDFQEW
LEQLYRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPP
LRPSAALSYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQI
LKVIEAYCTSANIQQGHGSSSRKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVY
ALKDEVKELKQVMKYTSRCSRERSRNKMVREKLVRRLLKQTDECIRADSSNKTSILP
Download sequence
Identical sequences G1PA37
ENSMLUP00000007133 ENSMLUP00000007133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]