SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007415 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007415
Domain Number 1 Region: 170-311
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-44
Family Third domain of FERM 0.00000011
Further Details:      
 
Domain Number 2 Region: 60-169
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-38
Family Second domain of FERM 0.000000594
Further Details:      
 
Domain Number 3 Region: 461-548
Classification Level Classification E-value
Superfamily Moesin tail domain 5.36e-32
Family Moesin tail domain 0.00000432
Further Details:      
 
Domain Number 4 Region: 3-58
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000132
Family First domain of FERM 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007415   Gene: ENSMLUG00000008116   Transcript: ENSMLUT00000008122
Sequence length 548
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429771:9963770:9975713:1 gene:ENSMLUG00000008116 transcript:ENSMLUT00000008122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDV
SEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAG
DKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIK
NKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVF
YAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMERALLENEKKK
REMAEKEKEKIEREKEELMEKLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKL
AKERQDAEEAKLALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKA
QMVQEDLEKTRAELKTAMSTPHVAEPAENDQDEQDENGAEASADLRADAMAKDRSEEERT
TEAEKNERVQKHLKALTSELANALDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQ
RIDEFESM
Download sequence
Identical sequences G1PAS9
ENSMLUP00000007415 ENSMLUP00000007415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]