SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007446 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007446
Domain Number 1 Region: 2-243
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.97e-78
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 1.6e-35
Family Filamin repeat (rod domain) 0.0000029
Further Details:      
 
Domain Number 3 Region: 1419-1527
Classification Level Classification E-value
Superfamily E set domains 3.87e-33
Family Filamin repeat (rod domain) 0.00000325
Further Details:      
 
Domain Number 4 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 6.67e-32
Family Filamin repeat (rod domain) 0.00000102
Further Details:      
 
Domain Number 5 Region: 1027-1127
Classification Level Classification E-value
Superfamily E set domains 2.6e-31
Family Filamin repeat (rod domain) 0.0000017
Further Details:      
 
Domain Number 6 Region: 1494-1611
Classification Level Classification E-value
Superfamily E set domains 3.67e-31
Family Filamin repeat (rod domain) 0.0000263
Further Details:      
 
Domain Number 7 Region: 1592-1707
Classification Level Classification E-value
Superfamily E set domains 3.07e-30
Family Filamin repeat (rod domain) 0.00000426
Further Details:      
 
Domain Number 8 Region: 430-546
Classification Level Classification E-value
Superfamily E set domains 1.9e-29
Family Filamin repeat (rod domain) 0.00058
Further Details:      
 
Domain Number 9 Region: 1806-1901
Classification Level Classification E-value
Superfamily E set domains 2e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 10 Region: 823-943
Classification Level Classification E-value
Superfamily E set domains 4.01e-28
Family Filamin repeat (rod domain) 0.00043
Further Details:      
 
Domain Number 11 Region: 643-753
Classification Level Classification E-value
Superfamily E set domains 2.04e-27
Family Filamin repeat (rod domain) 0.00072
Further Details:      
 
Domain Number 12 Region: 252-365
Classification Level Classification E-value
Superfamily E set domains 4.6e-27
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 13 Region: 2177-2273
Classification Level Classification E-value
Superfamily E set domains 5.27e-27
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 14 Region: 1987-2082
Classification Level Classification E-value
Superfamily E set domains 1.2e-26
Family Filamin repeat (rod domain) 0.00000342
Further Details:      
 
Domain Number 15 Region: 1130-1239
Classification Level Classification E-value
Superfamily E set domains 2.8e-26
Family Filamin repeat (rod domain) 0.00000415
Further Details:      
 
Domain Number 16 Region: 2500-2590
Classification Level Classification E-value
Superfamily E set domains 2.94e-24
Family Filamin repeat (rod domain) 0.0000179
Further Details:      
 
Domain Number 17 Region: 741-842
Classification Level Classification E-value
Superfamily E set domains 3.02e-24
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 18 Region: 542-639
Classification Level Classification E-value
Superfamily E set domains 4.14e-24
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 19 Region: 352-448
Classification Level Classification E-value
Superfamily E set domains 5.48e-24
Family Filamin repeat (rod domain) 0.00094
Further Details:      
 
Domain Number 20 Region: 2278-2369
Classification Level Classification E-value
Superfamily E set domains 5.6e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 21 Region: 2371-2462
Classification Level Classification E-value
Superfamily E set domains 7.34e-24
Family Filamin repeat (rod domain) 0.000015
Further Details:      
 
Domain Number 22 Region: 1888-1985
Classification Level Classification E-value
Superfamily E set domains 6.54e-22
Family Filamin repeat (rod domain) 0.00000261
Further Details:      
 
Domain Number 23 Region: 2099-2194
Classification Level Classification E-value
Superfamily E set domains 6.27e-21
Family Filamin repeat (rod domain) 0.0000114
Further Details:      
 
Domain Number 24 Region: 951-1051
Classification Level Classification E-value
Superfamily E set domains 4.54e-19
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 25 Region: 1745-1820
Classification Level Classification E-value
Superfamily E set domains 3.74e-16
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007446   Gene: ENSMLUG00000008090   Transcript: ENSMLUT00000008156
Sequence length 2591
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430133:902906:1036268:-1 gene:ENSMLUG00000008090 transcript:ENSMLUT00000008156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRENIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQLAKFTVDTISAGQGDLMVFVEDPEGNK
EEAQVTPASDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEAAGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MHPGPHVVKVTFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGIRIRETADFKVDTK
AAGSGELGVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGKYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGAEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPASGNYNPDLVQAYGPGLEKSGC
IVNNLAEFTVNPKDAGKAPLKIFAQDGEGQPIDIHMKTRMDGTYACSYTPVKPIKHTIAV
VWGGVNIPNSPYRVHIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFSSPLPGEAVKDLDIID
NYDYSHTVKYTPTQQGSMQVLVTYGGDPIPKSPFSVGVAAPLDLSKIKINGLENRVEVGK
DQEFAIDTRGAGGQGKLDVTILSPSRKVVPCLVAPVAGRESSTAKFIPREEGLYAVDVTY
DGHPVLGSPYTVEASLPPDPTKVKAHGPGLQGGLVGKPAKFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVMASG
PGLERGKVGEAGLLSVDCSEAGPGALGLEAVSDSGAKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRVKAFGPGIEGKDVFREATTDFTVDSRPLTK
VGGNHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYVPFAPGDYDVNITYGGNHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARIL
QSFTVDSSKAGLAPLEVRVVGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPKRAVVQDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASIVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVTEEAYVPVSDMNGLGFKPFDLVI
PFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESP
LQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDN
KDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDIS
ETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVS
IMVVQSEIGDARRAKVYGRGLSEGRTFEMSEFIVDTRDAGYGGISLAVEGPSKVDIQTED
LEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATV
GSICDLNLKIPEIDSSDMSAHVTSPSGRVTEAEIVPVGKNSHCVRFVPQEMGVHTVSVKY
RGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVE
GPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLT
VMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHE
NGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLEGGTTGIQSEFYINTTR
AGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPTHIVGSPFKAKV
TGQRLVSPGLANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKS
SFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGSQQYNVTYVVKEKGEYVLAVKWGEEH
IPGSPFHITVP
Download sequence
Identical sequences G1PAV7
ENSMLUP00000007446 ENSMLUP00000007446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]