SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007451 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007451
Domain Number 1 Region: 6-82
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000223
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007451
Domain Number - Region: 197-232
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0288
Family Trimerization domain of TRAF 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007451   Gene: ENSMLUG00000008165   Transcript: ENSMLUT00000008161
Sequence length 236
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429945:1101328:1103924:-1 gene:ENSMLUG00000008165 transcript:ENSMLUT00000008161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSVDEEALHQLYLWIDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPAN
SLQQKLSNWGHLNRKVLNKLNFSVPEDVMHQIVQCTPGVVELVLIPLRQRLEERRRRRKQ
GSGSLQELVPQDGSGYMDVGLSQKPRGEGAQDTQGGGQLRGGRQPVPRRPGYSQVLHGDP
SVILQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIDDLSRRLQQAERKQR
Download sequence
Identical sequences G1PAW0
ENSMLUP00000007451 XP_006096479.1.53796 XP_006758114.1.95426 ENSMLUP00000007451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]