SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007819 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007819
Domain Number 1 Region: 403-502
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-29
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007819   Gene: ENSMLUG00000008550   Transcript: ENSMLUT00000008579
Sequence length 841
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430140:115923:128507:1 gene:ENSMLUG00000008550 transcript:ENSMLUT00000008579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPDKLVVVWTRRNRRICSKAHSWQPGIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYEA
KEWTFVIENESKGQRKVLASAEVDLARHAGPVPAQVPLRLRLKAKSVKVVHAELSLTLSG
VLLREGRATDDDMQSLASLMSVKPSDVGNLDDFAESDEEEANGPGAPEARAQAPPPDPPR
ELKTLREEEEGRAQPRQAAASPSSTEDTSPAPVSVPAPPARASRGQGSEPATVVGGQVGP
EAPRPPGTPLETRSSRHPDQDLAPIPAPRLRKGSDAPCPSVPQGKDEAPKASGAPPAGVG
SAGETQAQASPQEGTEAQGAGPSPGVEDGGCRNSLEGQKVKAEEGTVGDRPEASGVDTEQ
GSGPRGVNTKRSEVRTGEAEESSEVSQVDAEQRSKALPTLVSSSQSLLEWCQEVTAGYRG
VRVTNFTTSWRNGLAFCAILHRFYPDKIDYASLDPLNIKQNNKQAFDGFAALGVSRLLEP
ADMVLLSVPDKLIVMTYLCQIRAFCTGQELQLVQLEGGGGAGTYRVASTQPSPPDDLDAS
GLAQRLREHRAESPEEPKEPKEAASRGEGAAPEEASKDQGAEAAKEARLRVPPRLRSPPS
CPRQGVVNGPEPGAEGAWVPLSSEREAGGAPPAGLRSESAGCHLVTTDLKGACKSRLHRA
GMETWGTNSHDGALATRLGAGEVGSLSEEGLSPAPGLPTAPAPAPQQPSGGSPPLEEPSP
NPGEEAGLQRFQDTSQYVCAELQALEQEQRQIDGRAAEVETQLRSLMASGANKLQEEVLI
QEWFTLVNKKNALIRRQDQLQLLIEEQDLERRFELLSRELRAMLAIEDWLKTAAQQHREQ
L
Download sequence
Identical sequences G1PBR5
ENSMLUP00000007819 ENSMLUP00000007819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]