SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008329 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008329
Domain Number 1 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.65e-75
Family Calponin-homology domain, CH-domain 0.000000554
Further Details:      
 
Domain Number 2 Region: 2819-2943
Classification Level Classification E-value
Superfamily EF-hand 1.48e-49
Family EF-hand modules in multidomain proteins 0.00000581
Further Details:      
 
Domain Number 3 Region: 2945-3040
Classification Level Classification E-value
Superfamily EF-hand 5.13e-38
Family EF-hand modules in multidomain proteins 0.0000157
Further Details:      
 
Domain Number 4 Region: 1898-2055
Classification Level Classification E-value
Superfamily Spectrin repeat 6.27e-25
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 3020-3108
Classification Level Classification E-value
Superfamily RING/U-box 9.89e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 284-392
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-20
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 362-500
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-17
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 8 Region: 2371-2524
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-16
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 9 Region: 2481-2613
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 942-1097
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-16
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 11 Region: 467-605
Classification Level Classification E-value
Superfamily Spectrin repeat 7.49e-16
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 12 Region: 1157-1308
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000047
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 13 Region: 2257-2415
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000282
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 14 Region: 2635-2774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000034
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 15 Region: 1467-1622
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000244
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 16 Region: 717-875
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000394
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 17 Region: 2026-2153
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000763
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 18 Region: 2781-2818
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 19 Region: 1595-1720
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000273
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 20 Region: 1390-1508
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000473
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008329
Domain Number - Region: 1281-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000226
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number - Region: 664-733
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000959
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008329   Gene: ENSMLUG00000009057   Transcript: ENSMLUT00000009141
Sequence length 3412
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429778:6490835:6826861:-1 gene:ENSMLUG00000009057 transcript:ENSMLUT00000009141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDEHNDVQKKTFTKWINARFSKSGKPPISDMFTDLKDGRKLLDLLEGLTGASLPKERGST
RVHALNNVNRVLQVLHQNNVDLVNIGGTDIVDGNHKLTLGLLWSIILHWQVKDVMKDIMS
ALQQTNSEKILLSWVRQSTRSYSQVNVLNFTTSWTDGLAFNALLHRHKPDLFSWDRVLKM
SPTERLEHAFQAQTYLGIEKLLDPEDVAVQLPDKKSIIMYLTSLFEVLPQQVTIDAIREV
ETLPRKYKRECEEGDMNIQSSAPEEEHGSPRADTPSTVTEVDMDLDSYQTALEDVLTWLL
SAEDTFQEQDDISEDVEEVKEQFATHEAFMMELTAHQSSVGSVLQAGNQLITQGTLSDEE
EFEIQEQMTLLNARWEALRVESMDRQSRLHDVLMELQKQQLQQLSAWLTLTEERIQKMET
CPLDDDLQSLQKLLEDHKSLQNDLEAEQVKVNSLTHMVVIVDENSGESATAVLEDQLQKL
GERWTAVCRWTEERWNRLHEINILWQELLEEQCLLKAWLTEKEEALNKVQTSNFRDQKEL
SISVRRLAILKEDMEMKRQALDQLSEIGQDVGQLLDNPKASKKINSDSEELTQRWDSLVQ
RLEDSSNQVTQAVGKLGMSQIPQKDLLETVHIREQVTTKRSKQELPPPPPPKKRQIPVDV
EAKKKFDALSAELLDWILKSKTAIQATEIKEYKKMQETSEMKKKLKGIEKEQTERRPRLD
ELNKTGQILLEQMGKEGLPTEDIKHILEKVLSEWKTVSQHLEDLARKIQLQEDTNTYFKQ
LDELDKTIKTKEEWLEHAPSSASPQQALRSVKSRPQRELTSLLGLHPGIETVRASCAALK
SRPSAPDFVQQSFERLLGRYQSVQQDLEDRQQQLENETEMKSQPGHAYLETLKTLKDMLN
DLESKAQTSLDVLNEPAKVEKALQEKKALDEILENKKPTLFKLAEETKALEKNVSPDVGK
MYNQEFNDVQGKWNKVKVKVSKDLHLLEEMIPKLRAFEADSKVIEKWMEGAKDFLMEEQA
VQGDAEGLQRQLDQCSAFVNEIDTVESSLKNMKEVETHLRSCPVAGIETWVQTKLVDYQT
QLEKCSKEISIHKNKLSERQEKVVNLKKDLSEMQEWMTQEEEEYLERDFEYKSPEELESA
VEEMKRAKEDVLQKEVKVKILKDNIKLMAKKVPSAGQELTSELDVVLENYQLLCNRIRGK
CHTLEEVWSCWIELLHYLDLETSWLNTLEERMRSTELPEKADAINEALESLESVLRHPAD
NRTQIRELGQTLIDGGVLDDIISEKLEAFNSRYEELSHLAESKQISLEKQLQVLRETDHM
LQVLQESLRELDKQLTTYLTDRVDALQVPQEAQKMQAEISAHELTLEELRRNARSQPPTS
PEGRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKD
VDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGRHIVQKQQTDNPKGLDEQLTSLKVLY
NDLGAQVTEGKQDLERASQLARKMKKEAASLSEWLSVTETELVQKSNSEGLLGDLDTEIS
WAKNILKDLEKKKADLNTITESSAALQNLVEGSEPVLEERLCVLNAGWSRVRTWTEDWCN
TLMSHQNQLEIFDGNVAHISTWLYQAEALLDEIEKKPASKQEEVVKRLLSELDDARLQVE
DVRDQAVVLMNARGGSCRELVEPKLAELNRNFEKVSQHIESANLLIGQEPLSYQSLATTE
ALEADVPFSDLEKLESDIEYMLKVVEKPLESSNEDEKMDEERAQIEEVLQRGEQMLHQPM
EDNKKEKIRLQLLLLHTRYNKTKAIPIQQKTTGQLASGIKSSLLPTDYLVEINKVLLSMD
DAELSLNTPELSTAVYEDFSFQEDALKNIKDQLDKLGEQIAVIHEEQPDVILEASVPEVM
QIRDMLTQLDAKWDRINRMYDDRKGYFDRTMEEWRQFHCDLNDLTQWTTEAEELLADTLA
PDGGLDLEKARVHQEELEEGINSHQPSFAALNRTGDGIVQRLSPTDGSFLKEKLAGLNQR
WGAIIAEVKDRQPRLKGESKQVMEYRKRLDEIICWLTKAENAVQKRSTTELEENRKELTD
LNQEMDIQAEKLKWLNRTELEMLSDKSLSLHEREKISESLRTVNSTWNKVCRDVPSALKE
CVPEPCSVSQSRTAAHPGALKVVLVSSASESSAQSPRTSEISIPADLDKTITELADWLVL
IDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQRHPQLDYVFTLAQNLKNKASSLDVRT
AITEKLEKVRNQWDSTQHGVELRQQQLEDMVIDSLQWDDHREETEELMRKYEARLYILQQ
ARRDPLIKQISDNQILLQELGPGDGIVMAFDNILQKLLGKYGSDDTRNVKETTEYLKASW
INLKQSIADRQNALEAELRAVQASRKDLENFLKWLQEAETTVNVLADASQRENALQDTVL
AKELTQQMQDIQAEIDAHNDIFKSIDGNRQKMVKALGNSEEATMLQHRLDDMNQRWNDLK
AKSASISRAHLEASAEKWNRLLMSLEELIKWLNMKDEELQQQMPIGGDVPALQLQYDHCK
ALRRELKEKEYSVLNAIDQARVFLADQPIEAPEEPRRNIQSKTELTPEERAQKIAKAMRK
QSSEVKEKWESLNAVTSNWQKQVDKALEKLRDLQGAMDDLDADMKEAEAVRNGWKPVGDL
LIDSLQDHIEKTMAFREEIAPINLKVKTMNDLSSQLSPLDLHPSLKMSRQLDDLNMRWKL
LQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQRSISHNKVPYYINHQTQTTCWDHP
KMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDLLELSTTNEVFKQHKLNQNDQLLS
VPDVINCLTTTYDGLEQLHKDLVNVPLCVDMCLNWLLNVYDTGRTGKIRVQSLKIGLMSL
SKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQIPRQLGEVAAFGGSNIEPSVRSC
FQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAASETAKHQAKCNICKECPIVGFRY
RSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTSGEDVRDFTKVLKNKFRSKKYF
AKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDPSQSPQLFHDDTHSRIEQYATRLAQ
MERSNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESSVSQPQSPVQILKSVEREERGEL
ERIIANLEEEQRNLQVEYEQLKEQHLRRELPVGSPPDSTVSPHHTSEDSELIAEAKLLRQ
HKGRLEARMQILEDHNKQLESQLHRLRQLLEQPETDSRINGVSPWASPQRSALSHSLDPD
AGPQFHQAAVPAAEDLLVPPHDTSTDLTEVMEQINSSFPSCCFSAELSPKTL
Download sequence
Identical sequences G1PD11
ENSMLUP00000008329 ENSMLUP00000008329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]