SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008505 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008505
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000307
Family Calponin-homology domain, CH-domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008505   Gene: ENSMLUG00000009300   Transcript: ENSMLUT00000009331
Sequence length 768
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429815:3511252:3589997:-1 gene:ENSMLUG00000009300 transcript:ENSMLUT00000009331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNIILFLRGCKELGLKESQLFDPSDLQDTSNRVTVKSLDYSRKLKNVLVTIYWLGKAANS
CASYSGTTLNLKEFEGLLAQMRKETDDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRD
DSFDSLDSFGSRSRQTPSPDVVLRGSSDGRGSDSESDLPHRKLPDVKKDDMSARRTSHGE
PKSAVPFNQYLPNKSNQTAYVPAPLRKKRAEREEYRKSWSTATSPLGGERPFRYGPRTPV
SDDAESTSMFDMRCEEEAVQPHSRARQEQLQLINSQLREEDDKWQDDLARWKSRRRSASQ
DLIKKEEERKKMEKLMAGEDGTSERRKSIKTYREIVQEKERRERELHEAYKNARSQEEAE
GILQQYIERFTISEAVLERLEMPKILERSHSTEPNFSPYLNDPNPMKYLRQQSLPPPKFT
ATVETTIARTSILDASMSAGSGSPSKTVAPKAVPMLTPKPYSQPKSSQEVLKTFKVDGKV
SMNGETVHSDEVEKENECPTDALVPSLTKSQMFEGVARVHGCPVELKQGSNSIEINIQKP
NSVPQDLTATTEEMEPNSQDEKDGENLKEGNTELTVSDCNSISEPQHFTTTVTRCSPTAA
SVEFSSSPKLRNDVPEERDQKKPENEMSGKVELVLSQKVVKPKSPEPEATLTFPFLDKMP
ETNQLHLPNLNSQGDSPSSEKSPATTPFKFWAWDPEEERRRQEKWQQEQERQLQERYQKE
QDKLKEEWEKAQKEVEEEERRYYEEERKIIEDTVVPFTISSSSADQLS
Download sequence
Identical sequences G1PDG3
ENSMLUP00000008505 ENSMLUP00000008505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]