SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009057 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009057
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 3.12e-41
Family Internalin LRR domain 0.015
Further Details:      
 
Domain Number 2 Region: 541-648
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-26
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009057   Gene: ENSMLUG00000009911   Transcript: ENSMLUT00000009934
Sequence length 686
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:262010:271840:1 gene:ENSMLUG00000009911 transcript:ENSMLUT00000009934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAIAASFAAGGEEAAATTSVPGSLGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSSLPSYICQLPLRVLIVSNNKLGALPPNISTLGSLRQLDVSSNELQSLPTELCS
LPSLRDLNVRRNQLSTLPDELGDLPLVRLDFSCNRISRIPVSFCRLRHLQVILLDSNPLQ
SPPAQICLKGKLHIFKYLSTEAGRRGGAALGDLAPSRPPSFSPCPAEDLFPGRRYDGGLD
SGFHSVDSGSKRWSGNESTDDFSELSFRISELAREPRGPRERKEDGCADGDPEQIDFIDS
HVPGEDEERGAAKEQQPPELSPVAGEKERAPSSRREELSGEERRRPDTLQLWQERERRQQ
QQQQSGVCGAPKKDSFLKLGVRAPGGGATALSTQATYNGMPKSSVTQLGASGGQGAPVSA
PTSQESPPIGGPVTAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRSPQLLDE
KELMAQLRQVLESRLQRPLPEDLAEALANGVILCQLANQLRPRSVPFIHVPSPAVPKLST
LKSRKNVESFLEACRKMGVPEADLCSPSDLLQGTAQGLWTTLEAVKRVGGRAPPPLWPPS
GLGGFILFYVVLMLLLYVVYTQLLGS
Download sequence
Identical sequences G1PEV3
ENSMLUP00000009057 ENSMLUP00000009057 XP_006081085.2.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]