SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009374 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009374
Domain Number 1 Region: 137-230
Classification Level Classification E-value
Superfamily TAFH domain-like 8.89e-36
Family TAFH domain-like 0.00000289
Further Details:      
 
Domain Number 2 Region: 424-471
Classification Level Classification E-value
Superfamily Histone-fold 2.18e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009374   Gene: ENSMLUG00000010291   Transcript: ENSMLUT00000010288
Sequence length 637
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430323:10352:35771:-1 gene:ENSMLUG00000010291 transcript:ENSMLUT00000010288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPGMVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQTTMAPRPATPTSAPPVQISTVQA
PGTPIIARQVTPTTIIKQVSQAQTTVQPAAALQRSPGVQPQLVLGGAAQTASIGTATAVQ
TGTPQRTVPGATTTSTAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQHLL
DGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPPAPQA
TTALTAVVLSSSVQRTAGKTAATVTSALQPPVISLTQPTQVGVGKQGQPTPLVIQQPPKP
GALIRPPQVTLTQTPMVALRQPHNRIVLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVS
AQAAAAQKNKLKEPGGGSFRRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCK
DETFLLPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSH
KDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKA
KEMQQQELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGTEGSGPGSAVPGSSGVGTPR
QFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences G1PFL1
ENSMLUP00000009374 ENSMLUP00000009374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]