SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009508 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009508
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-34
Family Calponin-homology domain, CH-domain 0.00092
Further Details:      
 
Domain Number 2 Region: 1939-2076
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000319
Family Nucleotide and nucleoside kinases 0.081
Further Details:      
 
Domain Number 3 Region: 1968-2015,2086-2173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000616
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009508   Gene: ENSMLUG00000010374   Transcript: ENSMLUT00000010433
Sequence length 2304
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429776:2071297:2317604:1 gene:ENSMLUG00000010374 transcript:ENSMLUT00000010433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMIE
NVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQQQHHQQQYYQSLVELQ
QRVPQASPQAEASQAKTQQDMQSSLAARYAAQSNHSGIATSQKKPTRLPGPSRVPAAGSS
SKAQGASNLNRRSQSFNSIDKNKPPTYANGNEKDSSKGPQPSSGINGNMQPPTTAGQPPA
SAIPSPSAKPWRSKSMNVKHSATSTMLTVKQSSPATSPTPPTDRLKPPGSEGVKTAPSGQ
KSMLEKFKLVNARTALRPPQPPSSGPSDGGKDDDVFSESGDMEGFSCGLNSGGSTNSSPK
ASPKLAPPKAGSKNLSNKKSLLQPKEKEDKNRDKNKVCAEKAVKDEKDQVTETAPKKTSK
IASLIPKGSKTTATKKESLIPSSSGIPKPGSKVPTAKQTISPGSTANKESEKFRTTKGSP
SQSLPKPVITEKASTSNCPAPLEGREAGQASPSGSCVGSVAQGSGQTTGNGAVQLPQQQQ
HSHPNTATVAPFIYRAHSENEGTSLSSADSCTSPTKMDLSYSKTAKQCLEEISGEDPETR
RMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDSTVTTEVNGRTIPNLTSRPTPMT
WRLGQACPRLQAGDAPSLGAGYPRSGTSRFIHTDPSRFMYTTPLRRAAVSRLGNMSQIDM
SEKASSDLDMSSEVDVGGYMSDGDILGKSLRTDDINSGYMTDGGLNLYTRSLNRIPDPVT
SRDAIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTDDLNTASSVSSYSNITLPSRKN
TQLKTDSEKRPTTDETWDGTEELKKAEEDFDSHGDGGGKWKGASSGLPEDPEKAGQKASL
AVSQTGSWRRGMSAQGGTSSRQKAGTSALKTPGKTDDTKASEKGKAPLKGSSLQRSPSDA
GKSSGDEGKKPPSGIARSTATGSFGFKKPSGVGSSPVITSSGATITGGSATLGKIPKSAA
IGGKSNAGRKTSLDGSQNQDDVVLHASSKASLQYRSLPRPSKSSASGIPGRGGHRSSTSS
IDSNVSSKSAGATTSKLREPTKIGSGRSSPVTVNQTDKEKEKVAVSDSESVSLSGSPKSS
PTSASACGTQGLRQPGSKYPDIASPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTT
LARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSLASSPASVHSFTS
GGLVWAANLSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLLM
RTGSVRSTLSESIQLDRNTLPKKGLRYTPSSRQANQEEGKEWLRSHSTGGLQDTGSQSPL
VSPSAMSASATGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSFDLYDDSQLCGSA
TSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEEKAHSEQIHKLRRELVAS
QEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQN
SAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSATSHSSIGSGNDADSKKKKKKNW
VNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNTGDGGSASMKPS
QSASASPLVWPPKKRRNGPVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRLEA
LSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPARPSSESSSSTSSSSSRQS
LGLSLNNLNITESVTSDILLDDAGDASGHKDGRSVKIIVSISKGYGHAKDQKSQAYLIGS
IGVSGKTKWDVLDGVIRRLFKEYVFRIDTSASLGLSSDCIASYCIGDLIRSHSLEVPELL
PCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTG
KTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQQYLASLAEQCSADNNGVELPV
VIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHT
EPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPR
LFLSCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRAPWEDPSKWVLDTYPWSS
ASLPQEGPALLQLRPEDVGYEGCISTKEATTSKHIPQTDTEGDPLMNMLMKLQEAANYSG
TQSFDSDSTSHHEDNLDSALESTL
Download sequence
Identical sequences G1PFX7
ENSMLUP00000009508 ENSMLUP00000009508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]