SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009771 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009771
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily L domain-like 5.44e-37
Family Ngr ectodomain-like 0.064
Further Details:      
 
Domain Number 2 Region: 568-685
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-29
Family Calponin-homology domain, CH-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009771   Gene: ENSMLUG00000010702   Transcript: ENSMLUT00000010720
Sequence length 694
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429872:1039657:1110199:1 gene:ENSMLUG00000010702 transcript:ENSMLUT00000010720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLSRNRLSEIPIETCHFVSLENLNLYQNCIRYIPEAILNLQALTFLNISRNQLSTLPVH
LCNLPLKVLIASNNKLVSLPEEIGHLRHLTELDVSCNEIQTIPSQIGNLEALRDLNLRRN
HLVRLPEELAELPLIRLDFSCNKITAIPVCYRNLKHLQMIALDNNPLQSPPAQICIKGKI
HIFKYLNIQACKIAPDLPDYDRRPLGFGSCHEELYSGRPYGALDSGFNSVDSGDKRWSGN
EPTDEFSDLPLRVAEITKEQRLRRENQYQENRSSVVVANGDVCVMWTVEHDLDQIDYIDS
CTAEEEEDEVRQPKGLDSDSLSSQFMAYIEQRRISHESSPIKPVPTREFQKTEDIKRYSH
QNRVRVPVGPSSSLLPSHNQLSHTDLELPQRREQLVERTRREAQLAALQYEEEKIRTKQI
QRDAVLDFVKQKTSHSPQKQQHPLDGECPFPSRRSQHTDDSALLVLLSGLKQVGYAGILP
HSSAFTPLKNDDRPNAVSSPPTTETVHHSPAYSFPAATQRNQPQRPESFLFRAGVRAETN
QGHGSTLLSSSEPTTDSTDPITRQNTRQREEELESIDQLRKHIEYRLKVSLPCDLGAALT
DGVVLCHLANHVWPRSVPSIHVPSPAVPKLSIAKCRRNVENFLEACRKIGVPQEQLCLPL
HILEEKGLSQVAVTVQALLALAPPKQQQHQLSAV
Download sequence
Identical sequences G1PGK4
ENSMLUP00000009771 ENSMLUP00000009771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]