SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010019 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010019
Domain Number 1 Region: 1015-1154
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.33e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000167
Further Details:      
 
Domain Number 2 Region: 164-248
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000002
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010019   Gene: ENSMLUG00000010991   Transcript: ENSMLUT00000010994
Sequence length 1160
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431052:29970:38753:-1 gene:ENSMLUG00000010991 transcript:ENSMLUT00000010994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQEHVKPPVTRLLLSAELYCRAWRQALPQLEAPPGPSALLALLARRGTVPALPERPVQEA
DLRHQPVLMGAHLAVIDALMVAFALEWTKTLPSPLALASLEHKLLFWVDTTIRRLQEKTE
NEAARKAAPAAPPKGAAPAQPSIRYRKDRTVARCAPCFPTVTGLQDLASGAALAATIHCY
CPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLLYVPPPLKINLVV
LLAEMFMCFEVLKPDFVQAKDLPDGHAASPQATEASTPQNSSGSSSPVFNFRHSLLSPGG
PQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDVDVVMGDPV
LLRSVSSDSLGPPRPVPALAPAHPPPEPGDLPTIEEALQIIHSAEPRLLPDGAADGSFYL
HSPEGPSKPPLVSPYPPDKAPAYLPHLEGPSKLSPCLAGEVLNPPALSEGSPKAGPSASA
ASNSEVKMTSFAERKKQLVKAEAEAGAGSPVSTPAEPAALSSEMSELGARLEEKRRAIEA
QKRRIEAIFAKHRQRLGKSAFLQVQPREAGGEAEAEAQVEAEAGPAPGGERPAGEGQGEP
SPRPKAVTFSPELGPVPPEGLGDYNRAVSKLSAALSSLQRDMQRLTDQQQRLLAPPEAPG
PTPPPASWVIPAPTMSPKAASASPTRRAPAVRRSPGPGPSPTPRSPKHARPAELRLAPLT
RVLTPPHDVDSLPHLRKFSPSQVPMQTRSSILLAEGPPPEEPLARPGLIEIPLGSLEEPL
AENEGDGSPPDADDSLEEDGSSEGVPRSGLGFFYKDEDKPEDEMAQKRASLLERQQRRAE
EVQRRKQWQEAKKEQQREEAARLAQEEVAPGPPAPTARAPAEEEAGPRRGEFTRLEYERR
AQLKLMDDLDKVLRPRASGGPGRGGRRAPRPRSGCCDDSALARSPARGLLGSRLSKIYSQ
STLSLSTVANEAPNNLGVKRSTSRAPSPSGLMSPSRLPGGRDWENGSNASSPASVPEYTG
PRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQF
RALYTLSGETEELSRLAGYGPRTITPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQ
GHLWQSKKPTTPKKGSSTPK
Download sequence
Identical sequences G1PH76
ENSMLUP00000010019 ENSMLUP00000010019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]