SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010744 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010744
Domain Number 1 Region: 91-235
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000007
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 2 Region: 551-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000906
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 755-788
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000683
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010744
Domain Number - Region: 789-817
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000285
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010744   Gene: ENSMLUG00000011774   Transcript: ENSMLUT00000011792
Sequence length 1009
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429786:8176078:8277218:-1 gene:ENSMLUG00000011774 transcript:ENSMLUT00000011792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWGSMEESKNETMNQAHTLFDQFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSK
LNYWKAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIE
KRDAFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIE
IHVSVEFQGLVHPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKE
FRGKLAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDT
HYFVMTAKKQSLLDKGVILHYDHQEKEFYYSGINIQFNFRSSFGRGARGNGPENGSGFTL
DVAVRSPGNPDSVRENFLSLIWSQFYLFFFRGQEPSFLCVLLNTKFILTTYLMVNKLFQG
PTRIKDLAQYVRNLQNRGGSIEPLGDRRLFHEMRLGPLSPSGLSGLPEPNVLCWPVRRKR
ESLRKIVINGKEMLKEGPGESVLFPREGSKKRMKSEKQIALSAKILCQSHKTQGEVGWRA
KTLVGSRKADHLLCKIIYLSNKDMKDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSSDALDLNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEVPRVCRGRSTLVSTLPDRRTDVTLSNQNK
VKYMATQLLAKFEENAPPQSTGIRRQGSVKKEFPQNLGGSDTCYFCQKRVYVMERLSAEG
KFFHRSCFKCDYCATTLRLSAYAYDIEDGKFYCKPHYCYRLSSSAQRKRPAVTLLSGKEA
RGPLQDGPIADANAPASTITNPADRTPGESSSVNGLEEPSIAKRLRGTPERIELENYRLS
VKQAEELQEVPEETQAEHNLSSVLDKGLEEDVASSSSESEMEEEEEPPLPTSDLGGVPWK
EAVRIHALLKGKSEEELDALKSYELNNDNEEEDYYEEEGEEDYDEEEEE
Download sequence
Identical sequences G1PJ30
ENSMLUP00000010744 ENSMLUP00000010744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]