SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010761 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010761
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.57e-85
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 245-367
Classification Level Classification E-value
Superfamily Spectrin repeat 7.67e-34
Family Spectrin repeat 0.000000579
Further Details:      
 
Domain Number 3 Region: 481-602
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 4 Region: 368-476
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 605-717
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-22
Family Spectrin repeat 0.00000234
Further Details:      
 
Domain Number 6 Region: 716-818
Classification Level Classification E-value
Superfamily EF-hand 4.33e-19
Family Calmodulin-like 0.084
Further Details:      
 
Domain Number 7 Region: 821-891
Classification Level Classification E-value
Superfamily EF-hand 2.24e-18
Family EF-hand modules in multidomain proteins 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010761   Gene: ENSMLUG00000011795   Transcript: ENSMLUT00000011812
Sequence length 892
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429852:3123147:3214205:-1 gene:ENSMLUG00000011795 transcript:ENSMLUT00000011812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPER
GKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVE
ETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPL
TNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRI
CKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRL
HKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWL
LNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLQQKDYETATLSEIKALLKKHEAFES
DLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEK
LLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDAD
KERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEH
ARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIINYK
PKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKG
ISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIANDPQKKTGMMDTDDFRACL
ISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITVDELRRELPPDQAEYCIARMAPYTGPDAVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences G1PJ47
ENSMLUP00000010761 ENSMLUP00000010761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]