SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010819 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010819
Domain Number 1 Region: 2-118,150-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-74
Family Calponin-homology domain, CH-domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 5943-6069
Classification Level Classification E-value
Superfamily Spectrin repeat 1.9e-17
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 4872-5022
Classification Level Classification E-value
Superfamily Spectrin repeat 8.34e-16
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 6185-6309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000331
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 5 Region: 5729-5885
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000346
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 6 Region: 6506-6622
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000331
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 7 Region: 6581-6725
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000561
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 8 Region: 6072-6151
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000036
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 9 Region: 5531-5664
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000924
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 10 Region: 3704-3851
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000016
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 11 Region: 5215-5347
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000432
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 12 Region: 2196-2325
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000843
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 13 Region: 3278-3436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000156
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 14 Region: 5134-5252
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000023
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 15 Region: 1864-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000468
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 16 Region: 2705-2802
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000892
Family Spectrin repeat 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010819
Domain Number - Region: 2077-2184
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000187
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 1461-1576
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000249
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 5305-5439
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00173
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 3185-3289
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00209
Family Spectrin repeat 0.025
Further Details:      
 
Domain Number - Region: 2754-2903
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00834
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 591-638
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0734
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 2015-2105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0954
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010819   Gene: ENSMLUG00000011730   Transcript: ENSMLUT00000011875
Sequence length 6854
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430186:231094:462457:1 gene:ENSMLUG00000011730 transcript:ENSMLUT00000011875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEQEDTQKRTFTCWINSQLAKHTPPSVISDLFTDIQKGHVLLDLLEVLSGQQLPRDKGSN
TFQCRLNIEHALTFLKSRSIKLINIHVADIIEGNPSIILGLIWIIILHFHIEELAQTLSC
NSNQPSLDDVSVAESSPTSSPPVKKCSKAQKRWQMSAKKALLLWAQEQCATSESVSVTDF
KSSWRNGMAFLAVIHALRPDLIDMKSVKQRSNKDNLREAFRIAERELKIPQLLEPEDVDV
VDPDEKSIMTYVAQFLQYSKDAPGTGDKAQGTMKDVMVWLTQQEKKLQKMLKDSENETYC
KKYESLLSFLESFSEGKKPVLDILSMKGNLDELNEDQLQLRKAWDGLNYQINVWKTKLND
DLPSPLHQIEAWLREEGLTEADLPTSHDYYEAIALMEEKMALFKRLMDKCDCHSNTLLAF
ENRDEKQLPLVPAYKLEEMKRRINNISGKKFTPLLEFHYYKCSVLGLLDEVKSKLKAWNI
KYGSKESVELLLEDWHKFIEEKDFLAQLESSFQKCEEIHKNLGGEYQNVSEQYMMMEHNI
SMCRKNIDNVKSTLQNVLACWTTYTEKLCFLKACFEETKKEQITEVPSETLSQWNLEHTT
LNEVGNFLIQVSNDEFGSSISKELRRLNKRWRKFVTKTQLEMKLPLIKKQEQPVLGNSEN
MQPSKEEKPTVDSPTDTPLALPENHHQNIKAGEEHEKEKEEFTGQLKVAEEVEKLTGEVE
IWEAETKSVLDLLRHKDDVDTSMEESLQHLIAKGSMYEELVSRMEDTLQMDVQNISSQES
LEHVLTAGLQAKIQEAKEKVQINMVKLGAMLKNSTDVSPDLSARMKVEESLKELESYITR
AEQLLGQRESRSGLISKYKEALLIFNTKSLAKYLKAVEELKNNVTEDVKLSLEEKSRDVC
AKWESLHHEMSLYIQQLKIDLEKGKISDTISRLEKQINKEKKLIRRGRTKGLMKEHAACF
SEEGSLHQLDHHMAVLRELCEELTSQKSQQEVRRVLQDYEQKIERLRKCASEIHATLQPP
VGGTSKNKGTASTSENGGRDAHREAPSANSDNRPSTAKAVGSIKNLSLASELKPEQEEKD
HNTSINSLQDRYDTHTETLELHLQNNKVRITSDFPSDGERSSACLQDKLEDLQVLKNETD
ACWKEFEITSLQLEELESDIKKPFIIKARDKLKEQEREFQMTLNTRMESLETALQLVIPV
EKASLLLCGSDLLLLHDVAIEEFHFTDADGIYQNLKDIQDSIAKQIDICNNLEQLGNFAL
KELHPLDLRATQTIILKHRSQLEETNHRVQRSRDALRALEDFLASLKTAALPGGLVTDPS
ASGTQVAPEDMLTVKNKEGEIYLMKEKARHLDKRLKMLDISFKDAGRGEDMSCEKLLNAL
AEPLFETRGSGGQEELTEEDKLLDACIFKNNELLKNILEVQSQISKIGLKDPTVPAVKQR
KKSLIRLEKDLDDYEKEKKHLQEMAGSLPQFKDGREKALSQQCQNTALLWESTKASVTEC
LDQCERVLELLKQYQNFKSVLTTLIQKEENVISLQASYMGKDNLKKRIAEIEIVKEEFNE
HLEVVDKINQICKNLQFHLNKMRTFEEPPFEKEANVIVDRWLDINEKTEDYYENLGQALA
LWDKLFSLKDVIDEWTEKVLQKMELHQLTEVERDMLKAELQVHEQKPSEFSKRVAKIQFL
LQSSEIPLELQVMESSILNKIEHVKMLLTGEPSCSALSGNTAELREDLDQAKTQIGMTES
LLKALSPSDSLEIFTKLEEIQQQILQQKQSMVSLENQIGCLTPELSELKKQYESVSDLFN
TKKSVLQDHFSKLLNDQCKNFNDWFSNIKMNLEECFESLDTKKSMEQKLQKLSDFLTLEG
RGSQVQQVETVVNRVRKHLPKARVQELNGWIIHQEIELEKMESVCQVRAKELDDYLQQLL
RLQDDHRNLSKWLTNQEEKWKEMEQSGEKTELFCQALARKREEFETVAQLNNSLKECGLT
EEEEIILESTHLIDRYQALLRQIEEEDKLPPAEDQSFNDLAQDVIHWITGIKESLMVLNS
SEGQMPLEETIQKIKEIILLKPEGDAKIQRIRSQAANSKAPLDSETVADIDSQWVSTLQL
ANTYLSHQEKLLLEGEKYLESKEDLRLMLTELKKKQEVGFALQHGLQEKKAQLKNYKKFL
QKAQDLTSLLKELKSQGNYLLECTKNPNFSEESWLEIKHLHESLLQQLQDSVQKLEGHVQ
EHHTYQDCITDLNTELDNISKECVSFSDKPVDPIKVEEKLQELQELENRLRLQDGPLEKI
LGLAKSIEQNTSSAGQKIIKEDIKSLKCKQKDLEHRLESAKQEMENYLNSILKSKCSTGK
KEKFPLPGGEKQVTSDVQESTQGSAAAEKLEEDLETNTNSAVEMLLSKQLSLDVQESMKN
TEDEQKVNELQNQPLELDVMLRNEQLKEIEELYTQLEARKAAIEPLEQTEYLNTTETSAL
ALHSPRNSAQHLDNLLQALATLKKNKERQYCLLQDFQEHLAAIESSLKVLLTEKESLKVG
SLDSATYVAKIQKLLASIEREKDSLSKLKIEWENISNSLSDMDQKLLESQVRQLEQGWKQ
VEQLVHRKYSQHEMEQEELTSLMSEIQELGLSLQRQHQRLRLRLGSPEGQERDTGAVALA
TELQAVKHRFSALKARAELQMKRIWGEKEKKILEDAINNLQKQLEASEPLNIEVDSEIRK
SEITNKVKETTLWVKNQLGELVSSISLLPDSILSQIRKCKMRHDGILGQQRAVEALAEEV
QDNIPNLTAGEREELESLLQDLQDQCQRLVLESTQRSQLLERKLEERSTFLAEIGKVQLS
LQGKETRIIPQVGTASTGAELERQRVVLTASQGELQEIASGLSAHLQELTRLCKDLSVFE
RLFLDDQLKSLETRASRTQRFIQHKCSEVGHKMRFSREFQEQTSALQKELDSVQHNELLL
SQEVSEGVKGELRGLLGRLRGVQSSIRQALRLKEAFDSLGLHWDCSQLDMLQFQVFEKER
ELEGKIKQLDTFMAEYGRYQASLSKLRVMDLQIKERAEAVLKTPPTSPESRLLGAQILNQ
RIERAMCLYHEIVKKLSENKAFDDSFKEEELLQTKLFAEENDKLQKVLQNIVLESQPKEM
DEKSFQEKLENSFHVLNQIKSQLQQPLLINLKIEHIQKEMDNCEAFQEQVQAEMCSIKGV
TVIEKQREKTSSEASDVETKLRDIEELHVQLNASIDMRTNVLNDAHENMTRYNEAVPRAM
GVVAALEAFVASHRVDLDHPEESLEMPRGKQEELGSTITDIQSLSEKLGAIASPAAQGQL
QCTLQELVSKNSALREAVRVKEAEIERCLENYTCYGKLEEKIGTDLRRTEAVLAQSMAPL
PVSYKEALERSEQSKALVSNLMSIKEEFMKLRQVLRHLRPTFTDSDGIGLLRTVWALWEK
WLSLLEVAKEWEMWCEELKQEWKFVNEEVEREAIILDNLQEELPEISKTKEAASTAELSE
LLECLRQYEETAEKQQLLLMLLLQRCRSAQRAPASGSSTEPAPAAQEITAMQERCNKLFQ
KAQKNKELVQNEIQERHSFTKELMTLKNLFQQTASSLQNMELQDHPERTEQFEELQSTSK
KGTLAFENIMEKLRIKYSEMYTIVPAEIDAQVEECRKALEDLEEKISNEVLKSSPSYAMS
RKIDEINKGLHKVEKMLQQKSKSIEKAQEIQKEMWDELDLWHSKLNELDSEVHDVVEQDP
GQAQEWMDRLMVPFQQYQQVSQRAEARTSQLNKATVKMEEYHDLLKSTEAWIENTSRLLA
NPADYDSSKTLSHHASTLQMALEDSEQKHNRLHSIFTELEDLSVIFETDDLAQSIQELSR
QVAALQQNIMESLPQIQRMADDVVAIETELKSMEKRVSKIKAILLSKEIFDFSPEEHLKH
GEVILENIHPMKKTIAEIMSYQVELRLPQTGMKPLPVFQRTNQLLQDIKLLENVTQEQNE
LLKIAIKQTNECDEEIDHLKEILNNYSAELSPEDMSPDQAASVPQVQGEVEGIEKQIMSL
DQKKEDLLADLKAAVLNLHRHLQQEQQELEKGKEVLSAGASEDEGVAERDESEWKLNRRG
SLPVLPAVKEEAEESSVKSESGDKAKPSSGSWSFLWKHDKDGEEDTASSSSGTIIQEEAG
KISTCDSSAAQVLAAGSLNPEQGPAFSPSPHQTEGGATPPIKAAALGFSVEQGALPSPVE
NPRPEPAEVLHACKTQVAELELWLHQASVAFEPETLNADMQQVVEQQLVGCQTMLTEIEH
KVASLLEHCKDQGLGDHGATQQEAEALALKLKTVKCNLEKVQLVLQEKYSEDQHSTILKK
PSEHQKVLQPDNLSEFESVVMERPQFGRQKDFPQQQVLELKPMEQKDLVKFIELNAKNMW
PEHCQPDNDTTQKSPVSGEAPSPENDAPDSVLSHQDLSGDKWRYLHQELSSKIQQPLPQL
VEPQVATEMSILPSVSVYNFRYPTAEELKTYTTQLEDLRQEANSLQTQENMTEETYIHLD
KQLFELFLTLSQCLGSVEELLQTPGLCREDVGAQQVFYETLALELKKLYLALSDKKKDLL
KAMTWPGRTANLFPECFENLQVYLEHTQAAAASRSKSLKAGLDYNRSYQNEIKRLYDQLI
KNKTSLQQSLNEISGQSIDEQLQKADAYTAELRNSESRVAKLRAEGEKLRLPYALLQEVY
KLEDVLDSMWGMLRARYAELGSPCVTESQQDALLRGLEELVTIGKEKLARDHLEQTKSKG
ALQAQIQNHKLFFQKLVADMLLIQTFSSKMLPSLLQKKETSWAEQVQEVKLLEEKACQCG
IKQQSLLQKWEEFDENYASLEKDLEVLASTLPSVSLVEETEDRLVERISFYQQIKRNVDE
KHARLYQTLNDGKQLVASVSCPELEGQIAKLEEQWLSLNKKIDHELHRLQTLLKHLLSYH
RDADQLTKWLESSQQTLNYWKEQSLNVSQDLDTIRSNIDRFFAFSKELDEKSSLKTAVIS
TGNQLLHLKEADAAALRAALAQFEQRWTVLVTQLPGIQEKLHQLQMEKLPSRKAITEMIS
WMNNVERQTAGEDAAPSLGSASQVKNLLQKYKEEELILGVGGGVLDDSQERELRILILKI
NIRKSWYPTNRCEHGFLRDIWFQVDLWLNHKIQHLEQLLESISENENKIQILNNWMEVQE
ERLKTLQKPESVVSVQKTLLDCQDIENQLAVKSKALDELRQSCLTSESGTVPLLEDTASR
IDGLFQKRSSVISQVNELKTSMQRLLQEWKIYDKLSDDVNRMTVRFGYCMEHSKPVVLSL
EALKCQVQNLQSLQDEAESSEGRWQKLQEVIGKLKGSCPSVAEIIEEKRHHTHTRWTQVN
HDIAEQLQTAQGLLHLWEAYASAHTEAVTRLDQQEAKYHQLANINMSGNNLAEILTPALR
DIKELQCDVQKTKEAFAQNSTRLDRLPQPAEPDTHVLLSGQRHSLQRASYLEKMLLVKAN
EFEFVLSQFKDFGDRLESLKGRITHEEENLDKLYQQEKEGNPDSFLNPVLALAAHSPEAE
QLNEVSLGLPLSDVAVKTLKDMNRQWIRATATALERCSELQGIRLHEQFLCCCEKWVRLL
EKIEETLKMSIADSLPALLEQQMAYEMLEAEVSINQTIADCYVTQSLQLLDTTEIEKRPA
FVSKFTQLKARWQSAAQSVRQRKRAVAALVRQWRFFSTPEGDLLRFLAATSQLLSAVRSQ
DCHSLFQTRSLIHELKNKEIRFERWQTTYELTLEAGEKLLSTTNPESKESVSKRISQLQD
NWKDTKIQVGEMIKHFQSIVETWDQCEKKIKELKSRLHVLKAQSKDPLPEPHEDLQKEKE
LIKELEKSLANWTQNLKELQTMKSDLTQHILVEDVMVLKEQIELLHRQWEDLCLRVAVRK
QEIEDRLNSWIVFNEKNKELCAWLVQMENKVLQTADVSIEEMIDKLQKDCMEEINLFSEN
KLQLKQMGDQLIKASNQTRAAEIDDKLSKINDRWQHLFDVIGSRVKKLKETFAFIQQLDK
NMSNLRTWLARIESELSKPVVYDVCDDQEIQKRLAEQQDLQRDIEQHSAGVESVFNICDV
LLHDSDACANETECDSIQQTTRSLDRRWRNICTMSMERRMKIEETWRLWQKFLDDYSRFE
DWLTSAERTAASPNSFGGALHSRKEELKRFEVDPLQPCPGDTGPPLPRPGTVRQSSGPKC
CSLAXQRWDGLQRRVTAVLRRLRHFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESD
ADDKMRQLNGFQQEITLNTNKIDQLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFG
RVARFHRRLTSHAPGLEDEKEASENETDMEDPREIQTDAWRKRREMEEPSSPQALCHLVP
PGPGPERSGCETPVSVDSIPLEWDHTGDVGGSSSHEDDEEGPYYSALSGKSISEAHSWHV
PDSPSCPKHRYKQMGGDRNVQPIPSDSSTPYKPAYVKLLLSPGTDGGKEGPSVLNGSPQP
EDEGLAPLTGQQSGAFDSWELIQAQELRKKLLMKQDLQQLNADVNDTITWLKNTEAELET
LKTAKPPSDAQELGLRVKRLKEILNALDTYKALVVSLNVSSKEFLQTGSGESKELHENVG
QLRLHWDAARAAVESWREGLRQSLMQCQDFHQLSQNLLLWLASAESRRQQAHVTDPKADP
QALLGCREELLQLEKELMERQPQVNSLQEISDSLLIKGHGEDYIEAEEKVHVIEKKLRRL
LEQVSHDLMSLQGSQIPDPSLPGLDEVDAGDQPPAVCVPASPAKETGAERTTKGKNRTDS
RVPGPADPGRSRPQRSFLSRVLRAALPLQLLLLLLLLLACLLPSSEEDYSCTQANNFARS
FYPMLRYTNGPPPT
Download sequence
Identical sequences G1PJ99
ENSMLUP00000010819 ENSMLUP00000010819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]