SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011404 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011404
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily L domain-like 1.53e-32
Family Leucine rich effector protein YopM 0.06
Further Details:      
 
Domain Number 2 Region: 511-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-26
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011404   Gene: ENSMLUG00000012524   Transcript: ENSMLUT00000012533
Sequence length 661
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429774:14177636:14292118:1 gene:ENSMLUG00000012524 transcript:ENSMLUT00000012533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIVNLQMLTYLNLSRNQLSTLPACL
CGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITALPQQIGQLKSLRELNVRRYL
KVLPQELVDLPLVKFDFSCNKVLVIPICFREMKQLQILLLENNPLQSPPAQICTKGKVHI
FKYLSIQACQIKATDSLYLHTMERPQLHQHVEDSKKDSDSGVGSDNGDKRLSATEPSDED
TVSLNVPMSNIMEEEQIIKEDSCHHLSPIKVGDFHQEFRSKPSLGDNDNSGEERDQFTHG
TDVLHSEFINYIKDRAEDCEELLRIEEDIHWQPEGITSSSKDQEMTTAMIEQLREAVDLL
QDPNRLSTDITEKNVVNFYPKESAEALELQDSALNGQMQLEPSPVCEVQNNLTSQSNGSE
YSPNKIRENSPAISPTTSSTAPFGLKPRSDPALTLPPISFNTLTQAQTWDNSSYSVPSEG
DSDNVFLRPQRNLESIDPQFTIRRKMEQMREEKELMEHLRESIEMRLKVSLHEDLGAALM
DGVVLCHLVNHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLEACRKLGVPEADLCSPY
DILQLDFRHIRKTVDTLLALGEKPPQPTSALRSRDLISFCLVHILFIVLIYITYRWNALS
A
Download sequence
Identical sequences G1PKR1
ENSMLUP00000011404 ENSMLUP00000011404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]