SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012942 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012942
Domain Number 1 Region: 6-100,131-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-66
Family Calponin-homology domain, CH-domain 0.0000815
Further Details:      
 
Domain Number 2 Region: 1569-1702
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-17
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 2388-2517
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000353
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 4 Region: 1348-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000468
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 5 Region: 501-641
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 6 Region: 2606-2732
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000758
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 7 Region: 1017-1169
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000162
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 8 Region: 1489-1598
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000107
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 9 Region: 1995-2123
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000484
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 10 Region: 1869-2019
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000851
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 11 Region: 1667-1809
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000015
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 12 Region: 2731-2810
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000528
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 13 Region: 831-957
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000141
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000012942
Domain Number - Region: 732-864
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0036
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 652-759
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00824
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1245-1346
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0192
Family Spectrin repeat 0.023
Further Details:      
 
Domain Number - Region: 2524-2596
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0248
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012942   Gene: ENSMLUG00000014185   Transcript: ENSMLUT00000014230
Sequence length 2810
Comment pep:novel scaffold:Myoluc2.0:GL429892:472:95773:-1 gene:ENSMLUG00000014185 transcript:ENSMLUT00000014230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRKPALVVEDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGR
RIKLVNINSTDIADGRPSIVLGLVWTIILYFQIEELTSNLPQLQALSSSTSSVDSTVSSE
AASPPSKRKVATKIQGNAKKALLKWVQYTAAKQTGIEIKDFGRSWRNGVAFHSVIHAIRP
ELVDLERVRGRSNRENLEEAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHY
PDVHNTGTDGLENDREDRLMLKETKVWIEQFERDLTRAQMTEANLQDKYQSFKHFRVQYE
MKRKQIEHLIQPLQRDGKLSLDQALVKQSWDRVSSRLFDWHIQLDKSLPAPLGTIGAWLY
RAEVALREEITIQQVHEETANTIQRKREQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPP
DQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRDSVELL
LQNYITFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSV
EVRSVRSMLEEVIANWDRYGDTVAGLQAWLEDAEKMLSQSELAKKDFFRNLPHWIQQHSA
MNDAGNFLIETCDEVVSRDLKQQLLLLNGRWRELFMEVKQYARADEVDRMKREYTDCVTA
LSDFATEAHRKLSEPLEVSFINVKLLIQDLEDIEQRIPVMDAQYKILTKTAHLVTKESSQ
EEAKEMFATMSGLKEQLTKVKERYSPLLYESQQLSVLLEELEKQMTLFYDSLGKISEIIT
VLEHEAQSSALFKQKHQELLACQESCKKAMAHIEKGSQSVQKFVTLSHVLKHFDQTKLQR
KTAEVHVAFQNMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRVAQEGLEEKGDPEEL
LWRHTEFYGQLDQRVLNAFLKACDDLTDILPEQEQAGLQEAVRKLHKQWKDLQGEAPYHL
LHLKIKVEENKFLACVEECRTELARETKLVPQEGSEKMIKEHRIFFSDKGPHHLCEKRLQ
LIEELCLKLPGRDPVRDTPGACQATLKELRAAIESTYTQLVEDPDKWKDYTSRISEFSSW
IAAKETQLKGIKKEAINTANHGEVKRAVEEIRNGVTQKGETLGWLKSRLQVLIEVSSEKE
AQKQGDELAKVSSSFKALTTLLSEIEKMLSSFGDCVQYKEIVKSSLKELISGSKEVQEQA
EEILDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQMTQAGQGEGGLPGPVQEELRKLES
TLDGLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSEL
EQTKEFSKRTEGIAVQAESLVKEASEIPLGPKNKQLLQQQAKSIKEQVKKLEDTLEEDIK
TMEMVKTKWEHFGNNFETLSVWITEKEKELNTLETSPSAMDMQTNQIKVTIQEIESKIGS
ITGLEEEAQSFAQFITTGESARIKAKLTQLRRYWEELREHAQGLEGTILGQVSQQQKFEE
NLRKAQQSVSEFEDKLADPIKTCSSATETYKALQEHMDLCQALESLSSALAALSAGAQKV
VSRGCSVQEAAALQQRYQGLLSRAKERQMALENLLAHWQRLEKELSTFLTWLERCEAIAG
SPEVDVTADRVKVESELQLTQALQSEVVCQASNYSNLVQLKESLFSVASKDDVKMMKLHL
EQLDERWRVLPQILSKRLHFLQSVVAEHQQFDELLLSFSVWIKQFLGELQATSEISLMDH
QALTISIHKDHAAEVESKRGELQSLQGHLAKLGALGRAEDLHVLQGKAEDCFQLFEEAGQ
VVERRQLALAQLAGFLQSHTSLSEALHRLRQTVEATNSMNKKQTDLLEKDLHDAIQDVKT
LESTAIGLDGVLTKAQYHLKCGSSGQRTSCRTSADHLCLELERIQNLLGTKQSEADALAS
LKKAFQDQREELLKSIEDIEERADKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWL
KDKAKQIAQKDVAFAPKVDTEINRLEVTWDDTKKLIHENQGQCCGLIDLMRDYQNLKSAV
SKVLEHASSVIATRTTIKDEEDLKWALSKHETARNEMCKEHKELDDFTSKGKQLLSELKK
IHSSDFILVKTDMESTMDRWLDVSSSPLLTKMYNHLKXLFVIWESLLGEWKAPEQEVTRC
PQAADGESEKPEKGALLASRALHRAVTEASSLLSSCLPRPVRFIEADLRQKLEHAKEITE
DAKGTLKDFRAQSTQVEKFINDITTWLAKLEESLVNCAQTETCEGLKKVKLDSSLNLCSQ
SPVLTQDSAKLLLKGVTSIEVNVFVKAQCNGLKARINSMVAHSMFWMHFSFMFFSKESMK
EFQEWFSGIKAAAKKSSDRTGDSKVLEAKLRDLQKQTILDSVGNGQRKLDAVTQEGQTLY
AHLPKQMVSSIQEQITKANEEFQAFLRQCLKDKQALQDCALELGSFEDQHRKLNLWIHEM
NERLSSENSGESKQHIPEKKNEVHRIEMFLGELLAARESLDKLSQRGQLLSEEGHGAGKE
GRLCSQLLTSYQGLVRMTKEKLRRCQAALQEHEALEEALQSMWAWVKGVQDKLACADSTV
GSKDTLEKRLLQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQKVIQTQLQTLTDVW
ANVMSSSVHAQSTLEAVISQWNDYLEWKNQLEQWMESVDQKVEHPLKPQPGLKEKFCLLD
HFQCIVSEGEDHAAALHRLTARSRELYQKTEDASFTETAQEELKTQFNDIMTVAKEKMRS
AEEMVKDHLLYVDAVQEFTDWLHSAKEELHRWSDPSGDSSATQKKLSKIK
Download sequence
Identical sequences G1PPK0
ENSMLUP00000012942 ENSMLUP00000012942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]