SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013037 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013037
Domain Number 1 Region: 31-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1044-1157
Classification Level Classification E-value
Superfamily E set domains 2.74e-37
Family Filamin repeat (rod domain) 0.00000502
Further Details:      
 
Domain Number 3 Region: 1528-1647
Classification Level Classification E-value
Superfamily E set domains 2.04e-34
Family Filamin repeat (rod domain) 0.00000873
Further Details:      
 
Domain Number 4 Region: 1332-1446
Classification Level Classification E-value
Superfamily E set domains 3.6e-34
Family Filamin repeat (rod domain) 0.0000324
Further Details:      
 
Domain Number 5 Region: 457-573
Classification Level Classification E-value
Superfamily E set domains 7.38e-33
Family Filamin repeat (rod domain) 0.00043
Further Details:      
 
Domain Number 6 Region: 1866-1961
Classification Level Classification E-value
Superfamily E set domains 5.07e-31
Family Filamin repeat (rod domain) 0.00000376
Further Details:      
 
Domain Number 7 Region: 2042-2144
Classification Level Classification E-value
Superfamily E set domains 8.53e-31
Family Filamin repeat (rod domain) 0.0000179
Further Details:      
 
Domain Number 8 Region: 671-779
Classification Level Classification E-value
Superfamily E set domains 6.11e-30
Family Filamin repeat (rod domain) 0.00034
Further Details:      
 
Domain Number 9 Region: 850-971
Classification Level Classification E-value
Superfamily E set domains 1.47e-29
Family Filamin repeat (rod domain) 0.00049
Further Details:      
 
Domain Number 10 Region: 1437-1548
Classification Level Classification E-value
Superfamily E set domains 1.61e-29
Family Filamin repeat (rod domain) 0.000033
Further Details:      
 
Domain Number 11 Region: 1147-1251
Classification Level Classification E-value
Superfamily E set domains 4.34e-29
Family Filamin repeat (rod domain) 0.0000897
Further Details:      
 
Domain Number 12 Region: 1242-1353
Classification Level Classification E-value
Superfamily E set domains 6.67e-29
Family Filamin repeat (rod domain) 0.0000143
Further Details:      
 
Domain Number 13 Region: 279-392
Classification Level Classification E-value
Superfamily E set domains 2.74e-27
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 14 Region: 2242-2334
Classification Level Classification E-value
Superfamily E set domains 3.8e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 15 Region: 564-666
Classification Level Classification E-value
Superfamily E set domains 6.61e-26
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 16 Region: 1636-1747
Classification Level Classification E-value
Superfamily E set domains 1.34e-25
Family Filamin repeat (rod domain) 0.0000663
Further Details:      
 
Domain Number 17 Region: 2542-2633
Classification Level Classification E-value
Superfamily E set domains 2.14e-24
Family Filamin repeat (rod domain) 0.0000189
Further Details:      
 
Domain Number 18 Region: 2340-2431
Classification Level Classification E-value
Superfamily E set domains 2.6e-24
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 19 Region: 768-869
Classification Level Classification E-value
Superfamily E set domains 2.24e-23
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 20 Region: 378-474
Classification Level Classification E-value
Superfamily E set domains 1.57e-22
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 21 Region: 2162-2255
Classification Level Classification E-value
Superfamily E set domains 5.14e-21
Family Filamin repeat (rod domain) 0.0000106
Further Details:      
 
Domain Number 22 Region: 958-1065
Classification Level Classification E-value
Superfamily E set domains 1.8e-20
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 23 Region: 1967-2064
Classification Level Classification E-value
Superfamily E set domains 5.87e-18
Family Filamin repeat (rod domain) 0.0000968
Further Details:      
 
Domain Number 24 Region: 1803-1883
Classification Level Classification E-value
Superfamily E set domains 2.2e-16
Family Filamin repeat (rod domain) 0.00014
Further Details:      
 
Domain Number 25 Region: 2433-2506
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000892
Family Filamin repeat (rod domain) 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013037   Gene: ENSMLUG00000014316   Transcript: ENSMLUT00000014332
Sequence length 2634
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429807:276710:301885:-1 gene:ENSMLUG00000014316 transcript:ENSMLUT00000014332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSHSRAGQSAAGAAPVGGNDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGSGDVEVTI
QDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTIGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVIVKGPKGEERVKQKDLGDGVYGF
EYYPTVPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKLGGKAPLRVQVQDNEGCPVE
ASVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGTAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGASVPCKV
EPGLGADNSVVRFVPREEGSYEVEVTYDGVPVPGSPFPMEAVPPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSE
AGLPAEVHIQDHGDGTHTITYIPLCPGSYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGVDGQGVFREATTEFSVDARALTKTGGPHVKARVANPSGNLTETYVQDCGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RTRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPF
KVPVHDVTDATKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLGPGLV
EPVDVVDNADGTQTVNYVPSREGPYSISVMYGEEEVPRSPFKVKVLPTHDASKVKASGPG
LNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTG
RYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITV
DTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNS
PFQVTALAGDQPTAQPPLRPQQLAPPYTYAQGAQQTWAPERPMVGVNGLDVTSLRPFDLV
IPFTIKKGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGS
PLQFYVDYVNCGHVTAYGPGLTHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKAEISCTD
NQDGTCSVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPIN
ISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKGGQHVASSP
IPVMISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINT
EDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVA
NVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSV
KYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIA
VEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARR
LTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIP
RENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNT
SNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYXGGSPFKAKVTGPRLVSNHSLHETSSV
FVDSMTKTASVPQHGAPGPGPTDASKVLAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVG
VHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDDHIPGSPYRVLVP
Download sequence
Identical sequences G1PPT4
ENSMLUP00000013037 ENSMLUP00000013037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]