SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013095 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013095
Domain Number 1 Region: 119-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.69e-161
Family Calponin-homology domain, CH-domain 0.00000000267
Further Details:      
 
Domain Number 2 Region: 5-94
Classification Level Classification E-value
Superfamily EF-hand 8.71e-18
Family Calmodulin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013095   Gene: ENSMLUG00000014393   Transcript: ENSMLUT00000014401
Sequence length 628
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429774:13570303:13633315:-1 gene:ENSMLUG00000014393 transcript:ENSMLUT00000014401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMARGSVSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMA
TGDLDQDGRISFDEFMKVFHGLKSTDIAKTFRKAINKKEGICAIGGTSEQSSVDTQHSYS
EEEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERT
INKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFAD
IELSRNEVLIALLREGESLEDLMKLSPEELLLRWANYHLENSGCSKISNFSTDIKDSKAY
YHLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGN
PKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSD
LSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIG
GQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDEIIVNWVNETLKEAEKRSSIS
SFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDEEKLNNAKYAISMARKIGARVYA
LPEDLVEVNPKMVMTVFACLMGKGMKRV
Download sequence
Identical sequences G1PPX9
ENSMLUP00000013095 ENSMLUP00000013095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]