SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014945 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014945
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-51
Family Calponin-homology domain, CH-domain 0.000000168
Further Details:      
 
Domain Number 2 Region: 194-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.18e-21
Family EB1 dimerisation domain-like 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014945   Gene: ENSMLUG00000016403   Transcript: ENSMLUT00000016399
Sequence length 268
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:3087239:3108014:1 gene:ENSMLUG00000016403 transcript:ENSMLUT00000016399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSENLSRHDMLAWINESLQLNLTKVEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDRLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAVAPSLVAPAMNKPKKPLSSSSAAPQRPIATHRTTATPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENNPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
Download sequence
Identical sequences G1PUI6
ENSMLUP00000014945 XP_006089465.1.53796 ENSMLUP00000014945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]