SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015014 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015014
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.5e-36
Family Calponin-homology domain, CH-domain 0.00000502
Further Details:      
 
Domain Number 2 Region: 164-223
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.83e-18
Family EB1 dimerisation domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015014   Gene: ENSMLUG00000016478   Transcript: ENSMLUT00000016478
Sequence length 246
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430101:9933:39760:1 gene:ENSMLUG00000016478 transcript:ENSMLUT00000016478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLV
KGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANS
PTAGAAKSSPASKPGSTPSRPSSAKRASSSGSASKSDKDLETQVLQLNEQVHSLKLALEG
VEKERDFYFGKLREIELLCQEQGQESDSLVQRLMEVLYASDEHGGPPEEPEAEEQAHEQP
PQQEEY
Download sequence
Identical sequences G1PUP8
ENSMLUP00000015014 ENSMLUP00000015014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]