SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015138 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015138
Domain Number 1 Region: 1278-1416
Classification Level Classification E-value
Superfamily PRC-barrel domain 5.81e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000153
Further Details:      
 
Domain Number 2 Region: 193-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000799
Family Calponin-homology domain, CH-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015138   Gene: ENSMLUG00000016600   Transcript: ENSMLUT00000016613
Sequence length 1422
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431361:17416:40692:1 gene:ENSMLUG00000016600 transcript:ENSMLUT00000016613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENVPEELREPFYTDQYDQEHIKPPVVHLLLSAELYCRAGSLILKSDAAKPLVGHDAVVQA
LAQKGLYVTDQERLVTERDLQRKPIQMSAHLAMIDTLMMAYTAEMVSVEKVIACAQRYST
FFQATDLPYDIEDAVMYWINKVNEHLKDILEQEQKLKEHHTVEAPGGQKSPSKWFWKLVP
ARYRKEQTLLRQLPCIPLVENLLKDGTDGCALAALIHFYCPGVVRLEDICLKETMSLADS
LYNLQLVQEFCQEHLTQCCHFSLEDMLYAAASIKSNYLVFMAELFWWFEVVKPSFVQPRV
LRAQGAEPAVRAPDARASTLDSSQGPASFPWKPVSRPHVSPPTPSPRPQPPSSAFRFEGG
IRRSSSMSYVDGFIGTWPKEKRSSVHGVSFDISFDKENTVPRGAPNRGLPRSVSNEGLSL
NNNRASKTTRKSLSFKPVNGEGEAGSIEEELSTDPRGGFPTYVPHPPHKLSSSENTRYQL
PNGALQPGLLLDELGNQVETPSIEEALQIIHDTEQRPLAPPPGHVANGFFLHSQDLSPLN
ANLQLRPPSPDRLTDTKGALSPVTDDTEVDTGIHVPSEDLPGTVDEDSSLRDYTVSLDSD
MDDAPKFLQDYDLRPGSAREAPSPCPSTVSTRSQPGSSASSSSGVKMTSFAEQKFRKLNH
TDGKSSGSSSQKTTPEGSELNIPHVVAWAQSPEDAGPPGRDSTQLLASEVLQLHMRLEEK
RRAIEAQKKKVEAAFTRQRQKMGRTAFLTVVKKRGDGGAPLREEAAGAEDEKEFSERAPE
RELPRASGQRSKSLADIKEGLEGAPAPWPTSPTDPERPWGAASPSEEPAPEGEVLEYTRS
IEKLNASLHFLQQEMQRLSQQQEALMRMRDRQSWVISPPQPAPHRPARDPRPARPGPSPE
PPRPTHPSPQPIHRKSASFSIKTPRTPRPNELKIAPLNRTLTPPRSVDSLPRLRRFSPSQ
VPIQTRSFVCFGDDGEPQLREPKPGKDGADPPEASEQPARPPGEAGKPVESSVSEVLAQP
VTETVCLTPSADPPGWPAEAAPRPAFPPAAPKNVSLIEVSLSDLKPPEKADVSVEKEDGE
SDREQLDDEQKVCCGFFFKDDQKAEDDMALKRAALLEKRLRREKETQLRKQQLEAEMEHK
KEETRRKTEEERQKKEDERARREFIRQEYLRRKQLKLMEDMDTVIKPRPPTAKQKKQRPK
SMHRDHMEPPKTPTQGPPVSSLSLASLTTGDSESVQSGKRTPRSESVEGFLSSSRCGSRN
GEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKRIL
EEMEKSDANNFLILFRDSGCQFRSLYTYCPETEDIAKLTGIGPKSISKKMIEGLYKYNSD
RKQFSHIPAKTLSASVDAITIHSHLWQSKRPVTPKKLLPTKA
Download sequence
Identical sequences G1PV00
ENSMLUP00000015138 ENSMLUP00000015138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]