SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015258 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015258
Domain Number 1 Region: 142-234
Classification Level Classification E-value
Superfamily TAFH domain-like 4.58e-33
Family TAFH domain-like 0.0000319
Further Details:      
 
Domain Number 2 Region: 537-585
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000314
Family TBP-associated factors, TAFs 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015258   Gene: ENSMLUG00000016736   Transcript: ENSMLUT00000016744
Sequence length 747
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430549:20358:69780:1 gene:ENSMLUG00000016736 transcript:ENSMLUT00000016744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGGTVLIKSNSGQLMLVSPQQPVTRAETTSTIISRPALPTNPQTVKICAMPNSNSQLI
KKVAVAPVKPLAQMGATVVTTVTKPSLVQSVAVPTSVVTVTPVKPSNTVTTLQPSSLGAS
HAPSSEPALKAGNSAAAQTNLTPAMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLV
GQLLDAKIEAEEFTRQLYVELKSSPQPHLVPFLKKSVSALRQLLPSSQSFIQQCVQQTSG
EAVVATGTTPVTAVATATDSSVQAERALVSGAATPRTVSAQSVNSFVGPGGANAGVVTLH
SVGPAAVAGGATAGTVVLQTPKPLVTSVQNTVAAVSLPPEKPVVSGAGVTLALPSVTLGE
TSSAVCLPSVKTVVTSAGTTSEKPVLGAPVQITLAQPGPVLSPSAALPQAVKVKQLVVQQ
PSGCISRQVGTLPPSSALTLQKKMPVSTAATSGQPPPATSILKQTTLPGNKILPLQVSSI
RKDKIKENGATSLRDEDDINDVTFMAGVNLNEESARILATNSELVGTLIQSCEDEPFLFI
GALQRRILDIGRKHDITELSSEAVSLISHATQERLRGLLEKLTTIARHRMTAYKTSENYI
LSSDTRSQLKFLEKLDQLEKQRKDLEEREILLKAAKSRANKEDPEQLRLKQKAKELQQLE
LAQIQQRDANLTALAAIGPRRKRPLEAGPGSEGLKDNLLAPGTCSLAGSRQLPRPRATRV
CLRDLVFCMEQERDMKHSRALYLALLK
Download sequence
Identical sequences G1PVA9
ENSMLUP00000015258 ENSMLUP00000015258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]