SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015613 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015613
Domain Number 1 Region: 315-414
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000011
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015613   Gene: ENSMLUG00000017119   Transcript: ENSMLUT00000017122
Sequence length 415
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429959:1440558:1501803:1 gene:ENSMLUG00000017119 transcript:ENSMLUT00000017122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAFHIDEENITVRNDKDPSLVKTSKHVSLSYEEDGLSSPAPSKCEEIDPAKRFFIGIEET
PGKVKSPRSEKPKKKGDKSVEKQEENKKFCPDPGTKAYDFIQKIVNAVQTWFSLFGWPDG
PHCLSVPDSIRRDVSKMQSFGSISLDQKHAKANNFLRYTKTIYDVIRHLSGVMPDGINPS
QSLPVDYIERLIQLHLQHSLVLDFLRARGAYLSYIQPEFLFEPEDYKKWVEEILINTKAL
SVCSSLPKERRYIVIDMTEFETWSQRAWTDVLLQIYKVLILSQILPHSPDDMPSIHTQKS
PKVNPCFIDSNVYSDSERLVLSWLNTNYENARHIVWKKCPKGTGIPSERWILNFDKHLSD
GLVFATVLGAYCPFLVEPYFMNMYTQPKGPEQYFHNCAIVVDSLREIGFSIGIQV
Download sequence
Identical sequences G1PW52
ENSMLUP00000015613 ENSMLUP00000015613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]