SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015705 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015705
Domain Number 1 Region: 770-1072,1112-1166,1211-1266
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-66
Family Calponin-homology domain, CH-domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1621-1714
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000145
Family Motor proteins 0.042
Further Details:      
 
Domain Number 3 Region: 1713-1800
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000531
Family Motor proteins 0.042
Further Details:      
 
Domain Number 4 Region: 2728-2825
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000673
Family Motor proteins 0.03
Further Details:      
 
Domain Number 5 Region: 1802-1878
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000637
Family Motor proteins 0.052
Further Details:      
 
Domain Number 6 Region: 1948-2022
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000876
Family Motor proteins 0.04
Further Details:      
 
Domain Number 7 Region: 1471-1533
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000133
Family Motor proteins 0.028
Further Details:      
 
Domain Number 8 Region: 2309-2363,2411-2439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000025
Family Motor proteins 0.027
Further Details:      
 
Domain Number 9 Region: 3016-3077
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000292
Family Motor proteins 0.023
Further Details:      
 
Domain Number 10 Region: 2090-2168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000345
Family Motor proteins 0.091
Further Details:      
 
Domain Number 11 Region: 1870-1945
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000478
Family Motor proteins 0.036
Further Details:      
 
Domain Number 12 Region: 3100-3225
Classification Level Classification E-value
Superfamily ARM repeat 0.0000576
Family RPA1889-like 0.06
Further Details:      
 
Domain Number 13 Region: 1531-1618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000637
Family Motor proteins 0.07
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015705
Domain Number - Region: 2021-2090
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000292
Family Motor proteins 0.069
Further Details:      
 
Domain Number - Region: 2221-2314
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000637
Family Motor proteins 0.04
Further Details:      
 
Domain Number - Region: 2163-2221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000929
Family Motor proteins 0.042
Further Details:      
 
Domain Number - Region: 1263-1329
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0247
Family Motor proteins 0.035
Further Details:      
 
Domain Number - Region: 2901-3016
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0717
Family Motor proteins 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015705   Gene: ENSMLUG00000017222   Transcript: ENSMLUT00000017228
Sequence length 3322
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430392:261246:286459:-1 gene:ENSMLUG00000017222 transcript:ENSMLUT00000017228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAPGRGGQGDWLSLRGGPGLHGGAARLRGRGRLGGGGPPPVLILRPLSCPRPFGCFGRLA
TRRFEERLPLAVSHPDAGATAVDVTPTDPPPGPALIGVLPNELQPKEKIVISVNWTPVKE
GRVREILTFLVNDILKHEVILLGNAEEPRKKKRSLWDTIKKKKVSSSSSHKKRISDIQNV
NQTFSVPPKADRVRSPLQACENLGGNEGCSPTENNSLILQENKIPISPISPTFKECRGDT
CLPLCVRRSTTYTSLHSPENGELWTLEGAHMRKEFNGKVVTETSFDSLTGINGQIEEDGK
RSLTPNCSSTWNMTQSQGDFLSPDSFVKNSRRASHKLESVPVSPDTFLKDDSRPRHLESN
TIHEMYQTILSPDSFLKDNYGLNQKLESESVNPFVSPNQFVRDNMPYLSLSQPTCELSPL
SKGHSQAPPSPPGQRKNEVLPLIPGSQGANSPKAIFAEPEASEMMPDGHRFTKQKQPAFP
AAQDTAGQAQGTQPRRRPILSATVTKPKPAGPRERGPEPSEPKARRCLHSAVGDCGTSAD
DLEEEEDALHPYLPVIDPAGGNPKGCRRAAPSCKAAFQARKRKSGGGEEDAAGAIAGTGH
AGERESKRIHFSPAEPRTSTAKKTNVPGTPASQCRSSRGRPHPRKKAAFKTPNSKTHKRT
PRMVPVAQASLTFIKRLKTDIPRHPMPFAAKNMFYDERWKEKQQQGLTWWLNFILTPDDF
AVKTHVSEVNAASLLLGGESHHKLSVPRAPTKEEVSLRAYTARRRLNRLRHAACRLFTSE
DMVKAIKKLEVEIAARRLAVRRDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETVFGELI
ALEDNSDVTGLAVFILHRLLWNPDIAAEYRHPSVPHLYRDGHEEALSAFTLKKLLLLVCF
LDRAKLSRLIDHDPCLFCKDAEFKASRDVLLAFSRGFLSGEGDLSRHLSWLGLPVSHVQT
PLDEFDFAVTNLAVDLQCGVRLVLTFSYHTRNWDLSKQLRIPAISRLQKMHNVELALQAL
RSRGVPLQDEQGGAILAKDIVDRHREKTLALLWKIALAFQVDISLNLDELKEEIDFLKRT
WRVKRSTPARSRPADAVLSEKTDTRPSDSSEQRPESIRLLMEWVQAVCAFYSVRVENFTV
SFSDGRVLCYLIHHYHPRCVPLDAIRQQTSQTVECAQSGSVVLNSSSESDESCLDLSLKA
LELAGKAPELHRELLENERRNFQLVSSAARDLGGIPAMVQHADMSNTIPDEKVVVTYLSF
LCARLLDLRRETRAARRIQAAWREYKLRADLQRHQERDQAARIIQAAVLGFLTRRRLRKE
AQAALAVQRRWRRLCRRRAVLRAEQAQLEKAQSQAASVIQRNWRRCSARKQFLRLRHYSV
VLQSRRRMVAAVASYKRHLWAAVTIQRHWRACVRRKQDQQSYRALRASCLVIQSAFRRWR
RREQRLQMRAAVTLQRAFREWRARKRAREEKAATALQAWYRAHRERQRYRHVRACVVLIQ
ARFRGFRARKLFQRKKASVLTIQQRWRAHLQGKAERARYLQVQAAALRLQAAFRAARARG
RRTQTRAACVLQAYWRMRRERARFLSLRQTVIRLQALVRKHQQLQNYRKMKSATLVIQVH
FRAYIAARRAQASYQETRAAVLVLQAACRGMRARRRFRLARTSVVKIQSHCRACIARRRF
LSLKHAAVQLQSIVRMRQARARYLRLRAAALFTQRRFRALKTAARRREEYRRVRAACIRL
QAFARGHLVRRQLRLQSSAAVTLQSCFRMREARRRFLRVRSAALVIQRAYRARQARLSCR
KRWQVLRAVTRLQAAYRGYRARQLLRRRSTAARKIQAAFRGHRERVRFRSVLWSAVTIQR
WYRARRTARDLRAQFFKARTAALSLQAACRGWKVRARIRREQQAALKIQAAFRAAQAQRQ
FRRLRTAALVLQGRWRARAAGRRQRVTYAGLRQAVLTLQAAWRGRTARRQIQKRHECATI
IQAQYRMHAQRRRWAALREAACLIQARYRAHRLGREQRFWYLKTKAAVVTLQAAFRRMRA
RRERARERGRAAAVIQSRYRAHRARRRYAACRASAITIQRWYRRVRAARQQRGEYLHVKE
AATHLQAAYRGLRARRQLQRMHTAATAIQAVFKMHQAQGRFRQVRAAAVVIQVRYRARRQ
GRAQRAQYLAVLQAARVLQASWRGARVRRTLRQMQSAAVLIQSCYRRYRQQRHFLQLKRA
TEAVQRRYRAAQAGRLQLQSYASLRRCVICVQAAFRGRRARRRVRALHLAAAVIQRRFRA
LRARRRFLSLRSTAIWVQRRYRANVRAKHRRQLLRLREAAVKIQAWVRGWLVRRRLREMH
RAATVVQAALRMHRARARYQALKQASVLIQRRYRAGRAVRLQREVCVGQRGAAEVLLAAQ
EGVKAGRLSQEQHRAAAIIQSAYRRHRWRLSHQQLRAAPGVTQERHGANEKEALDHCALS
KAAACTQAGSAAPAVGERIREQHPAAITVQPHLRAVRRRKRFLQFRAAVAFVQRRRRVAT
AALGLRSSCRGLRGHRDGDRRLRATTRIQASRRMHRARAAHRAESSAAAVVQSHCRSYVR
GTAGARRCSAARRPAPPVEAACRGPRGRRALGEASEGAVAASAGPPATRCDGPGAQQDAA
WSPVARPHSGAEAHSQGEAAVTRPPALQETAPGMLGAREPAALRVRPSLRTAECHSRFVR
RSRAAVTLPLSSRARRARRRFLLGRDAVAVQNRRRACASARLQRRAWLHIRSRVVIIQAW
TRGFLQKRKFQRIKASALTIQAAWRSYRARRRARAVEAACRIQAWFRGWKARKGYLAVLK
AVRAVQGRFRARRARARFLSVRASAVTIQRRWRATLCGRRAREHFLAMQKVIIGVALCPV
KVTHFKNILWTTIDLGPIHSALRRSRSSRPRQAGSVPEYSHTSLIMSTFKALTCCSWELQ
LNETSERRATVRLLHFAAAARYHLAAVRIQRAYRRHAAVRSAERHLDSIICIQRWFRARL
RLRRFMQICHSVIDLQHEVQERRRRQHRAASVIQAATRRFLLRREQERLRHGVVKIQALW
RGYALRKKNNCTKIKAIRRSLQALSGEVREEDKLYKRTALALFHLLTYKHLSAVLEALKH
LEVVTRLSPLCCENMAQSGAILKIFLLIRSCNRSVPCMEVVSYAVQVLLHVAKYEKTTAA
VGAVDGCMDTLLDLLRMYWEKPGDKIADKSGSIFTKTCCLLAVLLTAPSRASDVQSRSKV
ADCVYSIYRLTAHKHRVDAERTLHKQSQNCSGSLPRLPETPVRARMVARLQPGWVLRRDN
VQEITAPLQAVQLVMDTLGVPY
Download sequence
Identical sequences G1PWD7
ENSMLUP00000015705 ENSMLUP00000015705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]