SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017488 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017488
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.79e-18
Family Calponin-homology domain, CH-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017488   Gene: ENSMLUG00000029579   Transcript: ENSMLUT00000029543
Sequence length 252
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430599:197806:200729:1 gene:ENSMLUG00000029579 transcript:ENSMLUT00000029543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTSTFGV
KNAEKQTRRFRRRMRRPGTDAGFICNLKMGTNKCASRAGMTAYGTRRHLYDPKMQTDKPF
DQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDSSTISLQMGTNKVASQKGMS
VYGLGRQVYDPKYCAAPTEPVIRNGSQGTGTNGSEVSDSDSQAEYPDEYHGGYPDDDPRE
YQYGDPGLGLDY
Download sequence
Identical sequences G1Q1A5
ENSMLUP00000017488 ENSMLUP00000017488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]