SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018667 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018667
Domain Number 1 Region: 18-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.06e-25
Family Calponin-homology domain, CH-domain 0.0000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018667   Gene: ENSMLUG00000030051   Transcript: ENSMLUT00000026286
Sequence length 190
Comment pep:novel scaffold:Myoluc2.0:GL429821:6362054:6362656:1 gene:ENSMLUG00000030051 transcript:ENSMLUT00000026286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRARACGLSQEVQQKIAKQYHADLEQILILWITAQCGKDVGRPQPRHENIQNRLRDGV
LCERINGRYVPRGAGPVKKIQASSVAFKWMEQMSQFLSAAKRYGIYSTDIFQTRDLWEGK
MACVQRTLMKLGGLAVAWVMGFSLGIPAGFLRNPRKALRTYRTTSCKRMGTNHRASQAGM
TGYGMSCQFL
Download sequence
Identical sequences G1Q4N4
ENSMLUP00000018667 ENSMLUP00000018667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]