SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019611 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019611
Domain Number 1 Region: 78-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-32
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019611   Gene: ENSMLUG00000026744   Transcript: ENSMLUT00000024583
Sequence length 195
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429864:1222795:1227175:-1 gene:ENSMLUG00000026744 transcript:ENSMLUT00000024583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSELFCVVSLHPARCPRVPRSPLPPRRRRKRRHQNAGWQPLPGPGRAQNRKAIVDKFGGA
ASGPTALFRNTKAAGAAIGSVKNMLLEWCRAMTRNYEHVDIQNFSSSWSSGMAFCALIHK
FFPDAFDYAELDPTKRRHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQEL
YRCLVQKGLVKTKKK
Download sequence
Identical sequences G1Q7C8
ENSMLUP00000019611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]