SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020131 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020131
Domain Number 1 Region: 185-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000175
Family Calponin-homology domain, CH-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020131   Gene: ENSMLUG00000003261   Transcript: ENSMLUT00000022551
Sequence length 1374
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431050:732:20224:-1 gene:ENSMLUG00000003261 transcript:ENSMLUT00000022551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDNIPEDLRDPFYIDQYEQEHIKPPVIKLLLAGELYCRVCSLILKGDQAAALQGHQSVI
QALSRKGIYVMESDDTPVTDPDLSHAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKR
FSTFSASKELPYDLEDAMVFWVNKVNLKMREITEKEGKLRQQFLESPAHQKVRYRREHLS
ARQPPYFPLLEDLMRDGSDGAALLAVVHYYCPKHMKLDDVCLKEVMSMADSLYNIRLLRE
FSNEYLNRCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVRPDFVQPRDVQELKDAKT
VSHQKSSRPPVPISNATKRSFLGGPAAASPAEPPAPAQPPAEGCPRQHLHPEEPDPLGRG
ASAFSPSHPLLPLRQRQQRAAPGEDPPDERHRSSSLTRVDGQPRGAAVAWPEKKHRPASQ
PAPFALHHTASCDADPGSGDSVSLARSISKDSLASNILPLTPQNQPQTPALRASGKSLLN
NVDIEDEDEELMAIVRTNGAPHGSDRGPTTSARSPQRPAGPSESKLDSFFLEPLMPAVLR
PAKEKQAVSKEDECGEGRLRGCAARRPSEGPPLGRRKAPGSSGTRDLNRTFTPISSVELC
AEVGLPAGEARGEPLASGSFNPSSQGQSPDGFFLHVARADEAPEGGLHGTRARSPLARDP
EPWTVLRQDSDSDVADLEEAEHDFLGEDLPVLMGRYAGEEESAKLQEDMQVKEHEDKDGA
SGRSSPCLSTFSQFSGGFVAAGRARMPTLQRGKLQRTAMSQSPVRAASQKTTPDGLGELP
RAPPDPRGSKKRGAEPRAGQGWDHASLLASWVQLHMQLEEKRRAIEAQKKKMELSARQRL
KLGKAAFLHVVKKGKAEAGPQPLKPEPNEEDFSGAVSKTEEFLAREQGRGDAGECQDTDR
EGLALLQQHRQDPAALPELEKSKALSAALLEVAGDGLDTGEGDLSIEKLNETISTLQQAI
LRISQQQEQLLLKSPVPPAPGARNNAADPKVRASIHFVEPLSPTGVTGHRRPPRLGQGRN
SRSGRPAELKVARDRQQGSRSKTPTPSVEALPHLRPFPPRTPPDPGDPGSDPPEKGFFDS
YRLHDASNQRALTLPSPRDANILSEQMSLKEALGLGLREAGLGAPAVSGKEGVPVDGPPR
SKASLIEVDLSDLKAPDEDGPTGPESSVDLSTDGDQKSGVGFFFKKEEAQEDELAKKRAA
FLLKQQRKAEEARMRKQQLEAEVELKRDEARRKAEEDRIRKEEEKARRELIKQEYLRRKQ
QQILEEQGLGNQKAKPRKPRPKSVHREEPRGDSGTKCSSTPENLSRAQSGSSLSLASAAT
TEPESVHSGGTPAPRVESLEALPILSRNPSRSTDRDWETASAASSLASVAEYTG
Download sequence
Identical sequences G1Q8U8
ENSMLUP00000020131 ENSMLUP00000020131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]