SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020930 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020930
Domain Number 1 Region: 196-297
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000763
Family Calponin-homology domain, CH-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020930   Gene: ENSMLUG00000003261   Transcript: ENSMLUT00000025147
Sequence length 783
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431050:4117:20224:-1 gene:ENSMLUG00000003261 transcript:ENSMLUT00000025147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDNIPEDLRDPFYIDQYEQEHIKPPVIKLLLAGELYCRVCSLILKGDQAAALQGHQSVI
QALSRKGIYVMESDDTPVTDPDLSHAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKR
FSTFSASKELPYDLEDAMVFWVNKVNLKMREITEKEGKLRQQFLESPAHQKSPSKWYWKL
VPVRYRREHLSARQPPYFPLLEDLMRDGSDGAALLAVVHYYCPKHMKLDDVCLKEVMSMA
DSLYNIRLLREFSNEYLNRCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVRPDFVQP
RDVQELKDAKTVSHQKSSRPPVPISNATKRSFLGGPAAASPAEPPAPAQPPAEGCPRQHL
HPEEPDPLGRGASAFSPSHPLLPLRQRQQRAAPGEDPPDERHRSSSLTRVDGQPRGAAVA
WPEKKHRPASQPAPFALHHTASCDADPGSGDSVSLARSISKDSLASNILPLTPQNQPQTP
ALRASGKSLLNNVDIEDEDEELMAIVRTNGAQSKLDSFFLEPLMPAVLRPAKEKQAVSKE
DECGEGRLRGCAARRPSEGPPLGRRKAPGSSGTRDLNRTFTPISSVELCAEGQSPDGFFL
HVARADEAPEGGLHGTRARSPLARDPEPWTVLRQDSDSDVADLEEAEHDFLGEDLPVLMG
RYAGEEESAKLQEDMQVKEHEDKDGASGRSSPCLSTFSQFSGGFVAAGRARMPTLQRAMS
QSPVRAASQKTTPDGLGELPRAPPDPRGRLGPRQPPGLGSWVQLHMQLEEKRRAIEAQKK
KME
Download sequence
Identical sequences G1QB47
ENSMLUP00000020930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]