SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021911 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021911
Domain Number 1 Region: 86-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.31e-27
Family Skp1 dimerisation domain-like 0.0000162
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 1.57e-23
Family BTB/POZ domain 0.0000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021911   Gene: ENSMLUG00000029820   Transcript: ENSMLUT00000024484
Sequence length 164
Comment pep:novel scaffold:Myoluc2.0:AAPE02063722:10717:11233:1 gene:ENSMLUG00000029820 transcript:ENSMLUT00000024484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVETAKQSGTIKTMLEDLGMGDEGDDDPVPLPNVDAAILQKLLQ
WCTHHRDDPPPPPEDDENKGKRTVDIPVWDQEFLKVDQGTLFELTLAANYLDIKGLLDVT
FKTVANMIKGKTTEEIRKTFNIKHDFTEEQEAQVKRSEQWCLTL
Download sequence
Identical sequences G1QDX8
ENSMLUP00000021911 ENSMLUP00000021911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]