SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022198 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022198
Domain Number 1 Region: 995-1122,1154-1202
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-40
Family p120GAP domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 59-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.2e-39
Family Calponin-homology domain, CH-domain 0.0000166
Further Details:      
 
Domain Number 3 Region: 657-860
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000504
Family Motor proteins 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022198   Gene: ENSMLUG00000029396   Transcript: ENSMLUT00000027814
Sequence length 1211
Comment pep:novel scaffold:Myoluc2.0:GL430367:369971:448705:1 gene:ENSMLUG00000029396 transcript:ENSMLUT00000027814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPPTPAPLRSHRFLSRDLGSAAMSATEEVDGLSVFRPHYGSVLDNERLTAEEMDERRRQ
NVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYD
REQTRYKATGLHFRHTDNVIQWLNAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSL
YLFKLGLAPQIQDLYGKVDFTEEEINNMKIELEKYGIQMPAFSKIGGILANELSVDEAAL
HAAVIAINEAVDRRIPADTFAALKNPNAMLVNLEESLASTYQDVLYQAKHDKTTNARNRT
ENSERERDVYEELLTQAEIQGNVNKVNTFSALANVNLALDQGSALALFRILQSPALGLRG
LQQQNSDWYLKQLLSDRQQKRQSGQADALQKEELQAAVDAANSAAQQYQRRLAAVAAINA
AIQKGVAEKTVLELMNPEAQLPQVYPFAADLYQKELATLQQQSPEHSLTHPELSVAVEML
SSVALINRALESGDMNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKDQAHAEKNEFIT
WNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAGVAQ
HYQDTLIRAKREKAQETQDESAVLWLDEIQGGIWQSNKDTQEAQRSIVAVGIFAINEAVQ
SGDVGKTLSALRSPDVSLYGVIPECCETYQSDLAEARKKKLAAGDNNSKWVKHWVKGGYY
YYHNLDTQEGGWDEPPGFVQNSTQLSREEIQSSISGVTTAYNREQLWLANEGLITRLQAC
CRGYLVRQEFRSRLNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSL
ARMHQARKRYRDRLQYFRDHINDIVKIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHL
LDQSDQDFQEELDLMKMREEVITLIRSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSK
KLTKKNKEQLSDMMMLNKQKGGLKALSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQ
NKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMV
VSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYD
VTPEQALAHEEVKTRLDNSIRNMRAVTDKFLSAIISSVDKIPYGMRFIAKVLKDSLHEKF
PDAGEDELLKV
Download sequence
Identical sequences G1QER5
ENSMLUP00000022198 ENSMLUP00000022198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]