SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022509 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022509
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000171
Family Calponin-homology domain, CH-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022509   Gene: ENSMLUG00000027128   Transcript: ENSMLUT00000028585
Sequence length 808
Comment pep:novel scaffold:Myoluc2.0:GL429891:1887:101590:-1 gene:ENSMLUG00000027128 transcript:ENSMLUT00000028585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IENIDACLNFLAAKGINIQGLSAEEIRNGNLKAILGLFFSLSRYKQQQQQPQKQHLSSPL
PPAVSQAAGAPFQCQAGTPQQQVPATPQALCQPHQPAPHQQSKAQAEMQSSASSKDSSQS
KIIRFTLGQKKISRLPGPTTRVSAAGSDAKTRGGSAAANNRRSQSFNNYDKSKPVTSPPP
PPSSHEKVKTVIQPLASAASKPFFFFSLFPPTSPPLPALLSSQCPIPQTSSERKGWRPDP
VKINCISLWLVLQLRYGPLSDEVCDIISSPVPHTCKSPLVIIYKFSSDYSKQSPEMGDGR
KAILHPKFLSSFHEVTKHTGFTGHIALSDGRPVGASCQCASCGSAIYSFSGFLYNFKRSP
SGMKRSRNHQRAEVEAGFLEFASKAAEKRISGPPLPLLPSSSDGMVPGVETEPPLSGNPK
SEAAPVPGLGILNDRSRLERVSPSPAALWVSGKQRHSFTESFLPLPGVREATKMTFSIPP
SKSVLDSEFSEGRSTLLGEVGEGSGGAAFCRGLSHHCCSAPRGEGRTLWSPSLSALIPPE
KSSNPYPSCAQLGNFVPSFSTRTVQSITGKTACSSLSLKPSSSKTPKGEPECCFTLEMVT
GEDPEARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNVTTEVSGRSILSLT
GRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTESGRYVYPAPLRRQLASRG
SSVCHVDVSDKAGDEMDLEGLSVDAPGYMSDGDVLSKNIRTDDITSGYMTDGGLGLYTRR
LNRLPDGMAVVRETLQRNTSLGLGDADR
Download sequence
Identical sequences G1QFM6
ENSMLUP00000022509 ENSMLUP00000022509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]